RNF187 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RNF187 Antibody [NBP1-91025] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RNF187 Antibody [NBP1-91025] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells of seminiferus ducts.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RNF187 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RNF187 Antibody - BSA Free (NBP1-91025) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-RNF187 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HVMDRRKKALTDYKKLRAFFVEEEEHFLQEAEKEEGLPEDELADPTERFRSLLQAVSELEKKHRNLGLSMLLQ
• Predicted Species: Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF187
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RNF187 Protein (NBP1-91025PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25851810).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RNF187 Antibody - BSA Free

• E3 ubiquitin-protein ligase RNF187
• RACO-1
• RING domain AP1 coactivator 1
• ring finger protein 187

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RNF187 Antibody (NBP1-91025)(3)

Publications using NBP1-91025

• Chen J, Chen K, Zhou Z et al. RING finger protein 187 as a novel potential biomarker for predicting the prognosis of ovarian carcinoma in 2 cancer centers Current Problems in Cancer 2020-01-01 [PMID: 32057463] (IHC-P, Human)
• Wan W, Wu K, Peng K High level of RNF187 contributes to the progression and drug resistance of osteosarcoma J. Cancer 2020-01-02 [PMID: 32047542] (IF/IHC, Human)
• Chakraborty A, Diefenbacher ME, Mylona A et al. The E3 ubiquitin ligase Trim7 mediates c-Jun/AP-1 activation by Ras signalling. Nat Commun 2015-04-08 [PMID: 25851810] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: RNF187