RNF187 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RNF187 Antibody [NBP1-91025] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: RNF187 Antibody [NBP1-91025] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF187 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HVMDRRKKALTDYKKLRAFFVEEEEHFLQEAEKEEGLPEDELADPTERFRSLLQAVSELEKKHRNLGLSMLLQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF187
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RNF187 Protein (NBP1-91025PEP)
Publications
Read Publication using
NBP1-91025 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25851810).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNF187 Antibody

  • E3 ubiquitin-protein ligase RNF187
  • RACO-1
  • RING domain AP1 coactivator 1
  • ring finger protein 187

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-32441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80803
Species: Hu
Applications: ICC/IF, IHC, IHC-P
259-HE
Species: Hu
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92353
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54376
Species: Hu
Applications: WB, IHC

Publications for RNF187 Antibody (NBP1-91025)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for RNF187 Antibody (NBP1-91025) (0)

There are no reviews for RNF187 Antibody (NBP1-91025). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RNF187 Antibody (NBP1-91025) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF187 Products

RNF187 NBP1-91025

Bioinformatics Tool for RNF187 Antibody (NBP1-91025)

Discover related pathways, diseases and genes to RNF187 Antibody (NBP1-91025). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF187 Antibody (NBP1-91025)

Discover more about diseases related to RNF187 Antibody (NBP1-91025).
 

Pathways for RNF187 Antibody (NBP1-91025)

View related products by pathway.

Blogs on RNF187

There are no specific blogs for RNF187, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF187 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF187