RNF126 Antibody - Azide and BSA Free

Western Blot: RNF126 Antibody - Azide and BSA Free [RNF126] - Western blot analysis of various lysates, using RNF126 Rabbit pAb at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: RNF126 Antibody - Azide and BSA Free [RNF126] - Immunofluorescence analysis of NIH-3T3 cells using RNF126 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: RNF126 Antibody - Azide and BSA Free [RNF126] - Immunohistochemistry analysis of paraffin-embedded rat testis using RNF126 Rabbit pAb at dilution of 1:250 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry: RNF126 Antibody - Azide and BSA Free [RNF126] - Immunohistochemistry analysis of paraffin-embedded rat lung using RNF126 Rabbit pAb at dilution of 1:250 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry: RNF126 Antibody - Azide and BSA Free [RNF126] - Immunohistochemistry analysis of paraffin-embedded human colon using RNF126 Rabbit pAb at dilution of 1:250 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry: RNF126 Antibody - Azide and BSA Free [RNF126] - Immunohistochemistry analysis of paraffin-embedded mouse kidney using RNF126 Rabbit pAb at dilution of 1:250 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry: RNF126 Antibody - Azide and BSA Free [RNF126] - Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using RNF126 Rabbit pAb at dilution of 1:250 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RNF126 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit RNF126 Antibody - Azide and BSA Free (NBP3-15952) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human RNF126 (NP_919442.1). TGPPPADKEKIQALPTVPVTEEHVGSGLECPVCKDDYALGERVRQLPCNHLFHDGCIVPWLEQHDSCPVCRKSLTGQNTATNPPGLTGVSFSSSSSSSSSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF126
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:100 - 1:500
  • Immunohistochemistry-Paraffin 1:100 - 1:500
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for RNF126 Antibody - Azide and BSA Free

• FLJ20552
• MGC1022
• MGC14317
• ring finger protein 126

Background

The protein encoded by the RNF126 gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF126