RNF126 Antibody


Immunocytochemistry/ Immunofluorescence: RNF126 Antibody [NBP1-83645] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: RNF126 Antibody [NBP1-83645] - Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

RNF126 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PEETRSTENGSAPSTAPTDQSRPPLEHVDQHLFTLPQGYGQFAFGIFDDSFEIPTFPPGAQADDGRD
Specificity of human RNF126 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RNF126 Protein (NBP1-83645PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RNF126 Antibody

  • FLJ20552
  • MGC1022
  • MGC14317
  • ring finger protein 126


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for RNF126 Antibody (NBP1-83645) (0)

There are no publications for RNF126 Antibody (NBP1-83645).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF126 Antibody (NBP1-83645) (0)

There are no reviews for RNF126 Antibody (NBP1-83645). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RNF126 Antibody (NBP1-83645) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for RNF126 Antibody (NBP1-83645)

Discover related pathways, diseases and genes to RNF126 Antibody (NBP1-83645). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF126 Antibody (NBP1-83645)

Discover more about diseases related to RNF126 Antibody (NBP1-83645).

Pathways for RNF126 Antibody (NBP1-83645)

View related products by pathway.

PTMs for RNF126 Antibody (NBP1-83645)

Learn more about PTMs related to RNF126 Antibody (NBP1-83645).

Research Areas for RNF126 Antibody (NBP1-83645)

Find related products by research area.

Blogs on RNF126

There are no specific blogs for RNF126, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RNF126 Antibody and receive a gift card or discount.


Gene Symbol RNF126