Recombinant Human Rit2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Rit2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-217 of Human RIT2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDCLWKKLKGSLKKKRENMT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RIT2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Rit2 Protein

  • GTP-binding protein Rit2
  • GTP-binding protein Roc2
  • Ras-like protein expressed in neurons
  • Ras-like without CAAX 2
  • Ras-like without CAAX protein 2
  • RIBA
  • Ric (Drosophila)-like, expressed in neurons
  • Ric-like, expressed in neurons
  • RIN
  • Rit2
  • ROC2

Background

RIT2( AAH18060, 1 a.a. - 218 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4697
Species: Hu
Applications: WB
NBP1-85594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-88742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-2385
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
MAB59151
Species: Mu
Applications: WB
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00006014-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Rit2 Recombinant Protein (H00006014-P01) (0)

There are no publications for Rit2 Recombinant Protein (H00006014-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rit2 Recombinant Protein (H00006014-P01) (0)

There are no reviews for Rit2 Recombinant Protein (H00006014-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rit2 Recombinant Protein (H00006014-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Rit2 Products

Bioinformatics Tool for Rit2 Recombinant Protein (H00006014-P01)

Discover related pathways, diseases and genes to Rit2 Recombinant Protein (H00006014-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rit2 Recombinant Protein (H00006014-P01)

Discover more about diseases related to Rit2 Recombinant Protein (H00006014-P01).
 

Pathways for Rit2 Recombinant Protein (H00006014-P01)

View related products by pathway.

Research Areas for Rit2 Recombinant Protein (H00006014-P01)

Find related products by research area.

Blogs on Rit2

There are no specific blogs for Rit2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

POMC Antibody
NB100-1533

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Rit2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RIT2
Entrez