Rit2 Antibody

Images

 
Western Blot: Rit2 Antibody [H00006014-B01P] - Analysis of RIT2 expression in transfected 293T cell line by RIT2 polyclonal antibody. Lane 1: RIT2 transfected lysate(23.87 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Rit2 Antibody Summary

Immunogen
RIT2 (NP_002921.1, 1 a.a. - 217 a.a.) full-length human protein. MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDSLWKKLKGSLKKKRENMT
Specificity
RIT2 - Ras-like without CAAX 2,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
RIT2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Rit2 Antibody

  • GTP-binding protein Rit2
  • GTP-binding protein Roc2
  • Ras-like protein expressed in neurons
  • Ras-like without CAAX 2
  • Ras-like without CAAX protein 2
  • RIBA
  • Ric (Drosophila)-like, expressed in neurons
  • Ric-like, expressed in neurons
  • RIN
  • Rit2
  • ROC2

Background

RIN belongs to the RAS (HRAS; MIM 190020) superfamily of small GTPases (Shao et al., 1999 [PubMed 10545207]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4697
Species: Hu
Applications: WB
NBP1-85594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-88742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NB100-2385
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
MAB59151
Species: Mu
Applications: WB
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00006014-B01P
Species: Hu
Applications: WB

Publications for Rit2 Antibody (H00006014-B01P) (0)

There are no publications for Rit2 Antibody (H00006014-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rit2 Antibody (H00006014-B01P) (0)

There are no reviews for Rit2 Antibody (H00006014-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rit2 Antibody (H00006014-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rit2 Products

Bioinformatics Tool for Rit2 Antibody (H00006014-B01P)

Discover related pathways, diseases and genes to Rit2 Antibody (H00006014-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rit2 Antibody (H00006014-B01P)

Discover more about diseases related to Rit2 Antibody (H00006014-B01P).
 

Pathways for Rit2 Antibody (H00006014-B01P)

View related products by pathway.

Research Areas for Rit2 Antibody (H00006014-B01P)

Find related products by research area.

Blogs on Rit2

There are no specific blogs for Rit2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rit2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RIT2
Entrez
Uniprot