Recombinant Human Rit1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Rit1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 120-217 of Human RIT1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RVRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDS

Protein/Peptide Type
Partial Recombinant Protein
Gene
RIT1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Rit1 Protein

  • GTP-binding protein Rit1
  • GTP-binding protein Roc1
  • MGC125864
  • MGC125865
  • Ras-like protein expressed in many tissues
  • Ras-like without CAAX 1
  • Ras-like without CAAX protein 1
  • RIBB
  • RIBBRIT
  • Ric-like, expressed in many tissues
  • RIT
  • Rit1
  • ROC1
  • ROC1Ric (Drosophila)-like, expressed in many tissues

Background

RIT1 - Ras-like without CAAX 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03062
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-88742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-85594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
H00143384-B01P
Species: Hu
Applications: WB, ELISA

Publications for Rit1 Partial Recombinant Protein (H00006016-Q01) (0)

There are no publications for Rit1 Partial Recombinant Protein (H00006016-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rit1 Partial Recombinant Protein (H00006016-Q01) (0)

There are no reviews for Rit1 Partial Recombinant Protein (H00006016-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rit1 Partial Recombinant Protein (H00006016-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Rit1 Products

Bioinformatics Tool for Rit1 Partial Recombinant Protein (H00006016-Q01)

Discover related pathways, diseases and genes to Rit1 Partial Recombinant Protein (H00006016-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rit1 Partial Recombinant Protein (H00006016-Q01)

Discover more about diseases related to Rit1 Partial Recombinant Protein (H00006016-Q01).
 

Pathways for Rit1 Partial Recombinant Protein (H00006016-Q01)

View related products by pathway.

PTMs for Rit1 Partial Recombinant Protein (H00006016-Q01)

Learn more about PTMs related to Rit1 Partial Recombinant Protein (H00006016-Q01).
 

Research Areas for Rit1 Partial Recombinant Protein (H00006016-Q01)

Find related products by research area.

Blogs on Rit1

There are no specific blogs for Rit1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Rit1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RIT1
Entrez