RIPK5 Antibody


Western Blot: RIPK5 Antibody [NBP1-54845] - Human Spleen lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

RIPK5 Antibody Summary

Synthetic peptides corresponding to RIPK5(receptor interacting protein kinase 5) The peptide sequence was selected from the middle region of RIPK5. Peptide sequence EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RIPK5 and was validated on Western blot.
Theoretical MW
100 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RIPK5 Antibody

  • dual serine/threonine and tyrosine protein kinase
  • Dusty PK
  • Dusty protein kinase
  • DustyPK
  • KIAA0472RIP-homologous kinase
  • receptor interacting protein 5
  • receptor interacting protein kinase 5
  • Receptor-interacting serine/threonine-protein kinase 5
  • RIP5EC
  • RIPK5
  • sgK496
  • Sugen kinase 496


RIPK5 may induce both caspase-dependent apoptosis and caspase-independent cell death.This gene encodes a dual serine/threonine and tyrosine protein kinase which is expressed in multiple tissues. Multiple alternatively spliced transcript variants have been found, but the biological validity of some variants has not been determined.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Other, Pm, Rb
Applications: WB, Flow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
Species: Hu
Applications: WB

Publications for RIPK5 Antibody (NBP1-54845) (0)

There are no publications for RIPK5 Antibody (NBP1-54845).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIPK5 Antibody (NBP1-54845) (0)

There are no reviews for RIPK5 Antibody (NBP1-54845). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RIPK5 Antibody (NBP1-54845) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RIPK5 Products

Bioinformatics Tool for RIPK5 Antibody (NBP1-54845)

Discover related pathways, diseases and genes to RIPK5 Antibody (NBP1-54845). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIPK5 Antibody (NBP1-54845)

Discover more about diseases related to RIPK5 Antibody (NBP1-54845).

Pathways for RIPK5 Antibody (NBP1-54845)

View related products by pathway.

PTMs for RIPK5 Antibody (NBP1-54845)

Learn more about PTMs related to RIPK5 Antibody (NBP1-54845).

Research Areas for RIPK5 Antibody (NBP1-54845)

Find related products by research area.

Blogs on RIPK5

There are no specific blogs for RIPK5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RIPK5 Antibody and receive a gift card or discount.


Gene Symbol DSTYK