RIPK5 Antibody (4B3)

Images

 
Western Blot: RIPK5 Antibody (4B3) [H00025778-M07] - Detection against Immunogen (37.84 KDa) .

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RIPK5 Antibody (4B3) Summary

Immunogen
DSTYK (NP_056190, 80 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DVAETGLQAGQLSCISFPPKEEKYLQQIVDCLPCILILGQDCNVKCQLLNLLLGVQVLPTTKLGSEESCKLRRLRFTYGTQTRVSLALPGQYELVHTLVAHQGNWETIPE
Specificity
RIPK5 (4B3)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DSTYK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RIPK5 Antibody (4B3)

  • dual serine/threonine and tyrosine protein kinase
  • Dusty PK
  • Dusty protein kinase
  • DustyPK
  • KIAA0472RIP-homologous kinase
  • receptor interacting protein 5
  • receptor interacting protein kinase 5
  • Receptor-interacting serine/threonine-protein kinase 5
  • RIP5EC 2.7.12.1
  • RIPK5
  • sgK496
  • Sugen kinase 496

Background

This gene encodes a dual serine/threonine and tyrosine protein kinase which is expressed in multiple tissues. Multiple alternatively spliced transcript variants have been found, but the biological validity of some variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RIPK5 Antibody (H00025778-M07) (0)

There are no publications for RIPK5 Antibody (H00025778-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIPK5 Antibody (H00025778-M07) (0)

There are no reviews for RIPK5 Antibody (H00025778-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RIPK5 Antibody (H00025778-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RIPK5 Products

Research Areas for RIPK5 Antibody (H00025778-M07)

Find related products by research area.

Blogs on RIPK5

There are no specific blogs for RIPK5, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RIPK5 Antibody (4B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol DSTYK
Entrez
Uniprot