RING1 Antibody (2B3)

Images

 
Western Blot: RING1 Antibody (2B3) [H00006015-M03] - Analysis of RING1 expression in H9c2 (2-1).
Western Blot: RING1 Antibody (2B3) [H00006015-M03] - Analysis of RING1 expression in RIN-m5F.
Sandwich ELISA: RING1 Antibody (2B3) [H00006015-M03] - Detection limit for recombinant GST tagged RING1 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA
Clone
2B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RING1 Antibody (2B3) Summary

Immunogen
RING1 (NP_002922, 81 a.a. - 170 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMS
Specificity
RING1 - ring finger protein 1 (2B3)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RING1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RING1 Antibody (2B3)

  • EC 6.3.2
  • EC 6.3.2.-
  • Polycomb complex protein RING1
  • Really interesting new gene 1 protein
  • ring finger protein 1RING1A
  • RNF1E3 ubiquitin-protein ligase RING1

Background

This gene belongs to the RING finger family, members of which encode proteins characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The gene product can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain. The gene maps to the HLA class II region, where it is contiguous with the RING finger genes FABGL and HKE4. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47524
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5827
Species: Hu, Mu
Applications: WB
NBP2-02009
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84620
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-37371
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP1-84309
Species: Hu
Applications: WB, IHC, IHC-P
21650002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1556
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF4885
Species: Mu
Applications: WB, IP
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for RING1 Antibody (H00006015-M03) (0)

There are no publications for RING1 Antibody (H00006015-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RING1 Antibody (H00006015-M03) (0)

There are no reviews for RING1 Antibody (H00006015-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RING1 Antibody (H00006015-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RING1 Products

Bioinformatics Tool for RING1 Antibody (H00006015-M03)

Discover related pathways, diseases and genes to RING1 Antibody (H00006015-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RING1 Antibody (H00006015-M03)

Discover more about diseases related to RING1 Antibody (H00006015-M03).
 

Pathways for RING1 Antibody (H00006015-M03)

View related products by pathway.

PTMs for RING1 Antibody (H00006015-M03)

Learn more about PTMs related to RING1 Antibody (H00006015-M03).
 

Research Areas for RING1 Antibody (H00006015-M03)

Find related products by research area.

Blogs on RING1

There are no specific blogs for RING1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RING1 Antibody (2B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol RING1
Entrez
Uniprot