RIC8A Antibody - BSA Free

Western Blot: RIC8A Antibody [NBP3-35138] - Western blot analysis of various lysates using RIC8A Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 20s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RIC8A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RIC8A Antibody - BSA Free (NBP3-35138) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 362-531 of human RIC8A (NP_001273063.1).
  
  Sequence:
  DVRTRPEVGEMLRNKLVRLMTHLDTDVKRVAAEFLFVLCSESVPRFIKYTGYGNAAGLLAARGLMAGGRPEGQYSEDEDTDTDEYKEAKASINPVTGRVEEKPPNPMEGMTEEQKEHEAMKLVTMFDKLSRNRVIQPMGMSPRGHLTSLQDAMCETMEQQLSSDPDSDPD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RIC8A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 60 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RIC8A Antibody - BSA Free

• RIC8
• RIC8A resistance to inhibitors of cholinesterase 8 homolog A (C. elegans)
• synembryn
• synembryn-A

Background

RIC8 is a likely orthalog of mouse Synembryn. Synembryns are proteins that positively regulate synaptic transmission. They are actively required to maintain proper activity of the Go to Gq G-protein signalling network, which regulates neurotransmitter secretion in Caenorhabditis elegans by controlling the production and consumption of diacylglycerol. In addition to its role in the adult nervous system, synembryn is required to regulate a subset of centrosome movements in the early C. elegans embryo.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RIC8A