Recombinant Human RIC3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RIC3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-368 of Human RIC3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAYSTVQRVALASGLVLALSLLLPKAFLSRGKRQEPPPTPEGKLGRFPPMMHHHQAHSDGQTPGARFQRSHLAEAFAKAKGSGGGAGGGGSGRGLMGQIIPIYGFGIFLYILYILFKLSKGKTTAEDGKCYTAMPGNTHRKITSFELAQLQEKLKETEAAMEKLFNRVGPNGERAQTVTSDQEKRLLHQLREITRVMKEGKFIDRFSPEKEAEEAPYMEDWEGYPEETYPIYDLSDCIKRRQETILVDYPDPKELSAEEIAERMGMIEEEESDHLGWESLPTDPRAQEDNSVTSCDPKPETCSCCFHEDEDPAVLAENAGFSADSYPEQEETTKEEWSQDFKDEGLGISTDKAYTGSMLRKRNPQGLE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RIC3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RIC3 Protein

  • AYST720
  • FLJ11608
  • PRO1385
  • protein RIC-3
  • resistance to inhibitors of cholinesterase 3 homolog (C. elegans)

Background

RIC3 is a protein associated with nicotinic acetylcholine receptors (nAChRs), neurotransmitter-gated ion channels expressed at the neuromuscular junction and within the central and peripheral nervous systems, that can enhance functional expression of multiple nAChR subtypes (Lansdell et al., 2005 [PubMed 16120769]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56351
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
640-A3
Species: Mu
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20758
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
H00005956-R02
Species: Hu
NLS1049
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
H00079608-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for RIC3 Recombinant Protein (H00079608-P01) (0)

There are no publications for RIC3 Recombinant Protein (H00079608-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIC3 Recombinant Protein (H00079608-P01) (0)

There are no reviews for RIC3 Recombinant Protein (H00079608-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RIC3 Recombinant Protein (H00079608-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RIC3 Products

Bioinformatics Tool for RIC3 Recombinant Protein (H00079608-P01)

Discover related pathways, diseases and genes to RIC3 Recombinant Protein (H00079608-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIC3 Recombinant Protein (H00079608-P01)

Discover more about diseases related to RIC3 Recombinant Protein (H00079608-P01).
 

Pathways for RIC3 Recombinant Protein (H00079608-P01)

View related products by pathway.

Blogs on RIC3

There are no specific blogs for RIC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RIC3 Antibody
H00079608-B01P
5-HT3A Antibody
NB100-56351

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RIC3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RIC3