RIBC1 Antibody

Images

 
Western Blot: RIBC1 Antibody [NBP1-83521] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: RIBC1 Antibody [NBP1-83521] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RIBC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KERQNRFFNVRNRVMGVDVQALNNQVGDRKRREAAERSKEAAYGTSQVQYDVVVQMLEKEEADRTRQLAKKVQEFREQKQQLKNGREFSLWDPGQVWKGLPTYLSYSNTYPGPASLQYFS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RIBC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RIBC1 Protein (NBP1-83521PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RIBC1 Antibody

  • FLJ32783,2610028I09Rik
  • MGC46233
  • RIB43A domain with coiled-coils 1
  • RIB43A-like with coiled-coils protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02118
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-652
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P

Publications for RIBC1 Antibody (NBP1-83521) (0)

There are no publications for RIBC1 Antibody (NBP1-83521).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIBC1 Antibody (NBP1-83521) (0)

There are no reviews for RIBC1 Antibody (NBP1-83521). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RIBC1 Antibody (NBP1-83521) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RIBC1 Products

Bioinformatics Tool for RIBC1 Antibody (NBP1-83521)

Discover related pathways, diseases and genes to RIBC1 Antibody (NBP1-83521). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIBC1 Antibody (NBP1-83521)

Discover more about diseases related to RIBC1 Antibody (NBP1-83521).
 

Pathways for RIBC1 Antibody (NBP1-83521)

View related products by pathway.

Blogs on RIBC1

There are no specific blogs for RIBC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RIBC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RIBC1