Home » RhoC » RhoC Proteins » RhoC Recombinant Protein Antigen

RhoC Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for RhoC Protein (NBP2-38651PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

RhoC Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RHOC.

Source: E.coli

Amino Acid Sequence: KDLRKAGTWRTGSVPLATLSAQPRPRRECGRCLRWPLGLASRSARTSVGGAVPFSEIPKAFPTC
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RHOC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38651.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for RhoC Recombinant Protein Antigen

  • ARH9ARHCRho cDNA clone 9
  • H9
  • MGC1448
  • MGC61427
  • oncogene RHO H9
  • ras homolog gene family, member C
  • RAS-related homolog 9
  • rhoC GTPase
  • RhoC
  • RHOH9
  • rho-related GTP-binding protein RhoC
  • small GTP binding protein RhoC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Rhodopsin Antibody
(1D4)
NBP1-47602
Western Blot: Rhodopsin Antibody (1D4) [NBP1-47602] - Analysis of Human Cell lysates showing detection of Rhodopsin protein using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 1D4. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (1D4) [NBP1-47602] - Analysis using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 1D4. Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative and paraffin-embedded. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT. Localization: Dull epidermal staining.
(3 Publications)
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
RhoD Antibody
NBP1-58359
Western Blot: RhoD Antibody [NBP1-58359] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry: RhoD Antibody [NBP1-58359] - Human Liver Tissue Observed Staining: Cytoplasm in sinusoids of liver Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Expos
Immunohistochemistry-Paraffin: RhoD Antibody [NBP1-58359] - Human Tonsil Tissue, 4-8ug/ml.
Species: Hu
Applications: WB, IHC, IHC-P
RhoA Antibody
NB100-91273
Western Blot: RhoA Antibody [NB100-91273] - Rat spinal cord lysate using Rabbit antibody to Transforming protein RhoA: whole serum at 1:2000 dilution. One single band is detected.
Immunocytochemistry/Immunofluorescence: RhoA Antibody [NB100-91273] - Rat trigeminal at 1:500 dilution using Rabbit antibody to Transforming protein RhoA: whole serum (NB100-91273, in red), Sheep antibody to extracellular, N-terminal part of Sortilin: whole serum (NB100-98771, in green), DAPI counter stained appearing in blue.
Immunohistochemistry: RhoA Antibody [NB100-91273] - IHC on rat brain (paraffin sections) using Rabbit antibody to RhoA at a concentration of 15 ug/ml, incubated overnight and developed with DAB Ni.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
CD4 Antibody
NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with DyLight 488 (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
(8 Reviews)
(29 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NRSN1 Antibody
NBP2-31844
Immunocytochemistry/Immunofluorescence: NRSN1 Antibody [NBP2-31844] - Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles.
Immunohistochemistry-Paraffin: NRSN1 Antibody [NBP2-31844] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TMED2 Antibody
NBP1-80963
Western Blot: TMED2 Antibody [NBP1-80963] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: TMED2 Antibody [NBP1-80963] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TMED2 Antibody [NBP1-80963] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Calcium-binding-protei
NBP1-33736
Western Blot: Calcium-binding-protein-P22 Antibody [NBP1-33736] - A. 50 ug mouse liver lysate/extract 12 % SDS-PAGE
Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
TPPP/p25 Antibody
NBP2-34031
Western Blot: TPPP/p25 Antibody [NBP2-34031] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral cortex tissue.
Immunocytochemistry/Immunofluorescence: TPPP/p25 Antibody [NBP2-34031] - Staining of human cell line A549 shows localization to cytosol & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP2-34031] - Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
VEGF [HRP]
DVE00
(26 Reviews)
(514 Publications)
Species: Hu
Complement C3
Antibody (11H9)
NB200-540
Flow (Intracellular): Complement C3 Antibody (11H9) [NB200-540] - An intracellular stain was performed on RAW 246.7 cells with Complement C3 (11H9-3-2) antibody NB200-540 (blue) and a matched isotype control NBP2-31382 (orange). Cells were either treated with 3uM Monensin for 3 hours to block the secretion of Complement C3 (B) or grown in normal media (A). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) PE-conjugated secondary antibody (F0102B, R&D Systems).
Immunocytochemistry/Immunofluorescence: Complement C3 Antibody (11H9) [NB200-540] - C3 protein fragments deposited on kidney cells of MPL-lpr mouse. Staining with antibody 11H9. Glomerular staining pattern. Fixation in 4% paraformaldehyde in PBS pH 7.4. Vibratome sections of 4 um. Pretreated with 3% hydrogen peroxide for 20 min to quench endogenous peroxidases. Microwaved in antigen unmasking solution for 2-5 minutes as antigen retrieval.
Immunohistochemistry-Paraffin: Complement C3 Antibody (11H9) [NB200-540] - Complement C3 protein in a FFPE tissue section of mouse liver using 1:100 dilution of Complement C3 antibody (clone 11H9) NB200-540. Weak but distinct membrane-cytoplasmic immunopositivity was observed in hepatocytes and few cells developed punctate membrane staining.
(2 Reviews)
(9 Publications)
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(22 Reviews)
(302 Publications)
Species: Hu
RhoB Antibody
NBP2-20154
Western Blot: RhoB Antibody [NBP2-20154] - Rat tissue extract (50 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with RhoB antibody diluted at 1:1000.
Immunohistochemistry-Paraffin: RhoB Antibody [NBP2-20154] - detects RHOB protein at cytosol on U87 xenograft by immunohistochemical analysis. Sample: Paraffin-embedded U87 xenograft.
Western Blot: RhoB Antibody [NBP2-20154] - Sample (30 ug of whole cell lysate) A: U87-MG 12% SDS PAGE gel, diluted at 1:500.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H1F0 Antibody
NBP2-16772
Western Blot: H1F0 Antibody [NBP2-16772] - HepG2 whole cell extracts and nuclear extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with Histone H1 antibody (NBP2-16772) at a dilution of 1:10000 and developed with Trident Sharp-ECL.
Immunocytochemistry/Immunofluorescence: H1F0 Antibody [NBP2-16772] - Histone H1.0 antibody detects Histone H1.0 protein at nucleus by immunofluorescent analysis.Sample: U2OS cells were fixed in 4% paraformaldehyde at RT for 15 min.Green: Histone H1.0 stained by Histone H1.0 antibody diluted at 1:1000.Red: phalloidin, a cytoskeleton marker, diluted at 1:200.Scale bar= 10 um.
Immunohistochemistry-Paraffin: H1F0 Antibody [NBP2-16772] - Paraffin-embedded mouse brain. Histone H1.0 antibody diluted at 1:50
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RhoC Protein (NBP2-38651PEP) (0)

There are no publications for RhoC Protein (NBP2-38651PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RhoC Protein (NBP2-38651PEP) (0)

There are no reviews for RhoC Protein (NBP2-38651PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RhoC Protein (NBP2-38651PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional RhoC Products

Bioinformatics Tool for RhoC Protein (NBP2-38651PEP)

Discover related pathways, diseases and genes to RhoC Protein (NBP2-38651PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RhoC Protein (NBP2-38651PEP)

Discover more about diseases related to RhoC Protein (NBP2-38651PEP).
 

Pathways for RhoC Protein (NBP2-38651PEP)

View related products by pathway.

PTMs for RhoC Protein (NBP2-38651PEP)

Learn more about PTMs related to RhoC Protein (NBP2-38651PEP).
 

Research Areas for RhoC Protein (NBP2-38651PEP)

Find related products by research area.

Blogs on RhoC.

Check out the latest blog posts on RhoC.
Suppressing breast cancer metastasis: The role of hypoxia-induced RhoB expression and activation
By Jamshed Arslan, Pharm. D., PhD. The Ras homologous (Rho) GTPase family of signaling molecules has over 20 members, which typically cycle between active (GTP-bound) and inactive (GDP-bound) states. These small GTPa...  Read full blog post.

Customers Who Bought This Also Bought

VEGF [HRP]
VEGF [HRP]
DVE00
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RhoC Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RHOC