RhoC Recombinant Protein Antigen

Images

 
There are currently no images for RhoC Protein (NBP2-38651PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RhoC Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RHOC.

Source: E. coli

Amino Acid Sequence: KDLRKAGTWRTGSVPLATLSAQPRPRRECGRCLRWPLGLASRSARTSVGGAVPFSEIPKAFPTC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RHOC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38651.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RhoC Recombinant Protein Antigen

  • ARH9ARHCRho cDNA clone 9
  • H9
  • MGC1448
  • MGC61427
  • oncogene RHO H9
  • ras homolog gene family, member C
  • RAS-related homolog 9
  • rhoC GTPase
  • RhoC
  • RHOH9
  • rho-related GTP-binding protein RhoC
  • small GTP binding protein RhoC

Background

RhoC encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-80963
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
202-IL
Species: Hu
Applications: BA
NBP2-20154
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-47752
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC,  IHC-P, WB

Publications for RhoC Protein (NBP2-38651PEP) (0)

There are no publications for RhoC Protein (NBP2-38651PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RhoC Protein (NBP2-38651PEP) (0)

There are no reviews for RhoC Protein (NBP2-38651PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RhoC Protein (NBP2-38651PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RhoC Products

Research Areas for RhoC Protein (NBP2-38651PEP)

Find related products by research area.

Blogs on RhoC.

Suppressing breast cancer metastasis: The role of hypoxia-induced RhoB expression and activation
By Jamshed Arslan, Pharm. D., PhD. The Ras homologous (Rho) GTPase family of signaling molecules has over 20 members, which typically cycle between active (GTP-bound) and inactive (GDP-bound) states. These small GTPa...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RhoC Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RHOC