RhoC Antibody

Images

 
Western Blot: RhoC Antibody [H00000389-D01P] - Analysis of RHOC expression in transfected 293T cell line by RHOC polyclonal antibody.Lane 1: RHOC transfected lysate(22.00 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RhoC Antibody Summary

Immunogen
RHOC (NP_786886.1, 1 a.a. - 193 a.a.) full-length human protein. MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
Specificity
Reacts with ras homolog gene family, member C.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHOC
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RhoC Antibody

  • ARH9ARHCRho cDNA clone 9
  • H9
  • MGC1448
  • MGC61427
  • oncogene RHO H9
  • ras homolog gene family, member C
  • RAS-related homolog 9
  • rhoC GTPase
  • RhoC
  • RHOH9
  • rho-related GTP-binding protein RhoC
  • small GTP binding protein RhoC

Background

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-48588
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80963
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-20154
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16772
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000389-D01P
Species: Hu
Applications: WB

Publications for RhoC Antibody (H00000389-D01P) (0)

There are no publications for RhoC Antibody (H00000389-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RhoC Antibody (H00000389-D01P) (0)

There are no reviews for RhoC Antibody (H00000389-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RhoC Antibody (H00000389-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RhoC Products

Bioinformatics Tool for RhoC Antibody (H00000389-D01P)

Discover related pathways, diseases and genes to RhoC Antibody (H00000389-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RhoC Antibody (H00000389-D01P)

Discover more about diseases related to RhoC Antibody (H00000389-D01P).
 

Pathways for RhoC Antibody (H00000389-D01P)

View related products by pathway.

PTMs for RhoC Antibody (H00000389-D01P)

Learn more about PTMs related to RhoC Antibody (H00000389-D01P).
 

Research Areas for RhoC Antibody (H00000389-D01P)

Find related products by research area.

Blogs on RhoC

There are no specific blogs for RhoC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RhoC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHOC
Entrez
Uniprot