RHCE Recombinant Protein Antigen

Images

 
There are currently no images for RHCE Recombinant Protein Antigen (NBP3-17923PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RHCE Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RHCE

Source: E. coli

Amino Acid Sequence: LNLKIWKAPHVAKYFDDQVFWKFPHLAVGF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RHCE
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17923.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RHCE Recombinant Protein Antigen

  • blood group Rh(CE) polypeptide
  • blood group RhCcEe antigen
  • CD240CE antigen
  • CD240CE
  • MGC103977
  • Rh blood group antigen Evans
  • Rh blood group C antigen
  • Rh blood group, CcEe antigens
  • Rh polypeptide 1
  • Rh polypeptide I
  • RH
  • RH30A
  • Rh4
  • RHC
  • RHCE blood group variant Crawford antigen Rh43
  • RHE
  • Rhesus blood group CE protein
  • Rhesus blood group E antigen
  • Rhesus blood group Rhce antigen
  • Rhesus blood group, CcEe antigens
  • Rhesus C/E antigens
  • Rhesus system C and E polypeptides
  • RhIVb(J)
  • RHIXB
  • RHPI
  • RhVI
  • RhVIII
  • silenced Rh blood group CcEe antigen

Background

The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene which encodes both the RhC and RhE antigens on a single polypeptide and a second gene which encodes the RhD protein. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. A mutation in this gene results in amorph-type Rh-null disease. Alternative splicing of this gene results in four transcript variants encoding four different isoforms. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-84247
Species: Hu
Applications: WB
NB500-525
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NBP3-41526
Species: Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NB200-541
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
MAB1228
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
AF2009
Species: Hu
Applications: ICC, IHC
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-2421
Species: Hu
Applications: Flow, IHC,  IHC-P, PEP-ELISA, WB
NBP2-24750
Species: Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-89985
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
AF4670
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, Neut, WB
AF5065
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-67605
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, ISH, WB
NBP3-17923PEP
Species: Hu
Applications: AC

Publications for RHCE Recombinant Protein Antigen (NBP3-17923PEP) (0)

There are no publications for RHCE Recombinant Protein Antigen (NBP3-17923PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHCE Recombinant Protein Antigen (NBP3-17923PEP) (0)

There are no reviews for RHCE Recombinant Protein Antigen (NBP3-17923PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RHCE Recombinant Protein Antigen (NBP3-17923PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RHCE Products

Research Areas for RHCE Recombinant Protein Antigen (NBP3-17923PEP)

Find related products by research area.

Blogs on RHCE

There are no specific blogs for RHCE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RHCE Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RHCE