RHCE Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RHCE Source: E. coli
Amino Acid Sequence: LNLKIWKAPHVAKYFDDQVFWKFPHLAVGF Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
RHCE |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17923. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
21 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for RHCE Recombinant Protein Antigen
Background
The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene which encodes both the RhC and RhE antigens on a single polypeptide and a second gene which encodes the RhD protein. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. A mutation in this gene results in amorph-type Rh-null disease. Alternative splicing of this gene results in four transcript variants encoding four different isoforms. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
Species: Hu
Applications: ICC, IHC
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: Flow, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, Neut, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB
Species: Hu
Applications: AC
Publications for RHCE Recombinant Protein Antigen (NBP3-17923PEP) (0)
There are no publications for RHCE Recombinant Protein Antigen (NBP3-17923PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RHCE Recombinant Protein Antigen (NBP3-17923PEP) (0)
There are no reviews for RHCE Recombinant Protein Antigen (NBP3-17923PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for RHCE Recombinant Protein Antigen (NBP3-17923PEP) (0)
Additional RHCE Products
Research Areas for RHCE Recombinant Protein Antigen (NBP3-17923PEP)
Find related products by research area.
|
Blogs on RHCE