RGS16 Antibody


Western Blot: RGS16 Antibody [NBP1-55382] - Jurkat cell lysate, concentration 1.0ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

RGS16 Antibody Summary

Synthetic peptides corresponding to RGS16 (regulator of G-protein signalling 16) The peptide sequence was selected from the C terminal of RGS16. Peptide sequence DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RGS16 and was validated on Western blot.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RGS16 Antibody

  • A28-RGS14
  • A28-RGS14P
  • hRGS-r
  • regulator of G-protein signaling 16
  • regulator of G-protein signalling 16
  • Retinally abundant regulator of G-protein signaling
  • Retinal-specific RGS
  • RGSR
  • RGS-r


RGS16 belongs to the 'regulator of G protein signaling' family. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Pm
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: IHC-P
Species: Hu, Mk
Applications: IHC-P, ICC
Species: Hu
Applications: IHC-P
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB

Publications for RGS16 Antibody (NBP1-55382) (0)

There are no publications for RGS16 Antibody (NBP1-55382).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS16 Antibody (NBP1-55382) (0)

There are no reviews for RGS16 Antibody (NBP1-55382). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RGS16 Antibody (NBP1-55382) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RGS16 Products

Bioinformatics Tool for RGS16 Antibody (NBP1-55382)

Discover related pathways, diseases and genes to RGS16 Antibody (NBP1-55382). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS16 Antibody (NBP1-55382)

Discover more about diseases related to RGS16 Antibody (NBP1-55382).

Pathways for RGS16 Antibody (NBP1-55382)

View related products by pathway.

PTMs for RGS16 Antibody (NBP1-55382)

Learn more about PTMs related to RGS16 Antibody (NBP1-55382).

Research Areas for RGS16 Antibody (NBP1-55382)

Find related products by research area.

Blogs on RGS16

There are no specific blogs for RGS16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RGS16 Antibody and receive a gift card or discount.


Gene Symbol RGS16