RGS11 Antibody

Images

 
Immunohistochemistry: RGS11 Antibody [NBP2-48781] - Staining of human stomach, lower shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RGS11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GDRLVIACQEQTYWLVNRPPPGAPDVLEQGPGRGSCAASRVLMTKSADFHKREIEYFRKALGRTRVKSSVCLEAYLSFCGQRGPHDPL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RGS11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RGS11 Recombinant Protein Antigen (NBP2-48781PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RGS11 Antibody

  • regulator of G-protein signaling 11
  • regulator of G-protein signalling 11
  • RS11

Background

RGS11 is encoded by this gene belongs to the RGS (regulator of G protein signaling) family. Members of the RGS family act as GTPase-activating proteins on the alpha subunits of heterotrimeric, signal transducing G proteins. RGS11 has a G protein beta 5 subunit binding site. The RGS11 protein inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP bound form. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006000-B01P
Species: Hu, Rt
Applications: Flow, WB
H00010681-M01
Species: Hu
Applications: ELISA, PLA, S-ELISA, WB
NBP1-58919
Species: Hu
Applications: IHC, IHC-P, WB
NB100-56659
Species: Hu, Mu, Rt
Applications: WB
NBP2-46123
Species: Hu
Applications: IF, IHC, IHC-P, WB
NBP1-32728
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-22470
Species: Bv, Mu
Applications: ICC, IP, WB
NB300-189
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP1-32521
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
664-LI/CF
Species: Hu
Applications: BA
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-58415
Species: Hu
Applications: IHC, IHC-P
NBP2-94071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00005998-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-48781
Species: Hu
Applications: IHC, IHC-P

Publications for RGS11 Antibody (NBP2-48781) (0)

There are no publications for RGS11 Antibody (NBP2-48781).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS11 Antibody (NBP2-48781) (0)

There are no reviews for RGS11 Antibody (NBP2-48781). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RGS11 Antibody (NBP2-48781) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RGS11 Products

Bioinformatics Tool for RGS11 Antibody (NBP2-48781)

Discover related pathways, diseases and genes to RGS11 Antibody (NBP2-48781). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS11 Antibody (NBP2-48781)

Discover more about diseases related to RGS11 Antibody (NBP2-48781).
 

Pathways for RGS11 Antibody (NBP2-48781)

View related products by pathway.

PTMs for RGS11 Antibody (NBP2-48781)

Learn more about PTMs related to RGS11 Antibody (NBP2-48781).
 

Research Areas for RGS11 Antibody (NBP2-48781)

Find related products by research area.

Blogs on RGS11

There are no specific blogs for RGS11, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGS11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS11