RFC3 Antibody [FITC]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: FITC

RFC3 Antibody [FITC] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human RFC3 (NP_002906.1).
  
  Sequence:
  MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RFC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for RFC3 Antibody [FITC]

• A1 38 kDa subunit
• Activator 1 38 kDa subunit
• Activator 1 subunit 3
• MGC5276
• replication factor C (activator 1) 3 (38kD)
• replication factor C (activator 1) 3, 38kDa
• Replication factor C 38 kDa subunit
• replication factor C subunit 3
• RFC, 38 kD subunit
• RFC38RF-C 38 kDa subunit

Background

The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 38 kD subunit. This subunit is essential for the interaction between the 140 kD subunit and the core complex that consists of the 36, 37, and 40 kD subunits. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RFC3