Recombinant Human Retinol Binding Protein RBP Protein

Product Discontinued

Recombinant Human Retinol Binding Protein RBP Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-135 of Human RBP1 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ

• Preparation Method: in vitro wheat germ expression system
• Protein/Peptide Type: Recombinant Protein
• Gene: RBP1

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Retinol Binding Protein RBP Protein

• C
• Cellular retinol-binding protein
• CRABP-I
• CRBP1CRBP-I
• CRBPCellular retinol-binding protein I
• CRBPI
• RBPC
• retinol binding protein 1, cellular
• retinol-binding protein 1
• retinol-binding protein 1, cellular

Background

RBP1 is the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. The gene harbors four exons encoding 24, 59, 33, and 16 amino acid residues respectively. The second intervening sequence alone occupies 19 kb of the 21 kb of the gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: RBP1