RERG Antibody

Images

 
Western Blot: RERG Antibody [NBP1-68972] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RERG Antibody Summary

Immunogen
Synthetic peptides corresponding to RERG (RAS-like, estrogen-regulated, growth inhibitor) The peptide sequence was selected from the C terminal of RERG. Peptide sequence CAFYECSACTGEGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAIN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RERG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RERG and was validated on Western blot.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RERG Antibody

  • MGC15754
  • RAS-like, estrogen-regulated, growth inhibitor
  • ras-related and estrogen-regulated growth inhibitor

Background

RERG, a member of the RAS superfamily of GTPases, inhibits cell proliferation and tumor formation (Finlin et al., 2001 [PubMed 11533059]).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-12154
Species: Hu
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20119
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBL1-12155
Species: Hu
NB300-539
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fe, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NLS4271
Species: Hu, Rt, Mk, Pm
Applications: WB, IHC-P, IF
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
NBP1-68972
Species: Hu
Applications: WB

Publications for RERG Antibody (NBP1-68972) (0)

There are no publications for RERG Antibody (NBP1-68972).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RERG Antibody (NBP1-68972) (0)

There are no reviews for RERG Antibody (NBP1-68972). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RERG Antibody (NBP1-68972) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RERG Products

Bioinformatics Tool for RERG Antibody (NBP1-68972)

Discover related pathways, diseases and genes to RERG Antibody (NBP1-68972). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RERG Antibody (NBP1-68972)

Discover more about diseases related to RERG Antibody (NBP1-68972).
 

Pathways for RERG Antibody (NBP1-68972)

View related products by pathway.

PTMs for RERG Antibody (NBP1-68972)

Learn more about PTMs related to RERG Antibody (NBP1-68972).
 

Research Areas for RERG Antibody (NBP1-68972)

Find related products by research area.

Blogs on RERG

There are no specific blogs for RERG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RERG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RERG
Uniprot