Recombinant Human Reg1A GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related Reg1A Peptides and Proteins

Order Details


    • Catalog Number
      H00005967-Q02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Reg1A GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 23-122 of Human Reg1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: QEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
REG1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Reg1A GST (N-Term) Protein

  • ICRF
  • Islet cells regeneration factor
  • Islet of Langerhans regenerating protein
  • lithostathine-1-alpha
  • P19
  • pancreatic stone protein, secretory
  • Pancreatic thread protein
  • protein-X
  • PSP
  • PSPS
  • PSPS1
  • PTP
  • REG
  • Reg1A
  • REG-1-alpha
  • Regenerating islet-derived protein 1-alpha
  • Regenerating protein I alpha

Background

This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. Reg family members REG1B, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
1290-IL
Species: Hu
Applications: BA
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF3954
Species: Mu, Rt
Applications: Simple Western, WB
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-83276
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NBP3-12954
Species: Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00005967-Q02
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Reg1A Partial Recombinant Protein (H00005967-Q02) (0)

There are no publications for Reg1A Partial Recombinant Protein (H00005967-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Reg1A Partial Recombinant Protein (H00005967-Q02) (0)

There are no reviews for Reg1A Partial Recombinant Protein (H00005967-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Reg1A Partial Recombinant Protein (H00005967-Q02). (Showing 1 - 2 of 2 FAQ).

  1. I want to set up ELISA for the detection of human Reg1 protein in serum and stool samples. Can you provide me the information of appropriate standards and pairs of antibodies to be used in ELISA?
    • A list of our paired antibodies for use in ELISA for Reg1 can be found at the following link: Reg1 paired antibodies. For these pairs, H00005967-Q01 should be used as a standard.
  2. I would like to know how many tests can be done from these antibodies?
    • These pairs are produced by a Taiwanese company called Abnova and we distribute for them. We do no in-house testing or development of their products. As is clearly listed on our datasheet, all of these antibody pairs utilize a biotinylated secondary antibody, so all are suitable for use with avidin peroxidase. It also states that Reagents are sufficient for at least 3-5 x 96 well plates using recommended protocols. Please see Abnova's recommended protocol.

Additional Reg1A Products

Research Areas for Reg1A Partial Recombinant Protein (H00005967-Q02)

Find related products by research area.

Blogs on Reg1A

There are no specific blogs for Reg1A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Reg1A GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol REG1A