Recombinant Human Reg1A GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human Reg1A GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 23-122 of Human Reg1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: QEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYK

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: REG1A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 36.63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Reg1A GST (N-Term) Protein

• ICRF
• Islet cells regeneration factor
• Islet of Langerhans regenerating protein
• lithostathine-1-alpha
• P19
• pancreatic stone protein, secretory
• Pancreatic thread protein
• protein-X
• PSP
• PSPS
• PSPS1
• PTP
• REG
• Reg1A
• REG-1-alpha
• Regenerating islet-derived protein 1-alpha
• Regenerating protein I alpha

Background

This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. Reg family members REG1B, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for Reg1A Partial Recombinant Protein (H00005967-Q02). (Showing 1 - 2 of 2 FAQ).

1. I want to set up ELISA for the detection of human Reg1 protein in serum and stool samples. Can you provide me the information of appropriate standards and pairs of antibodies to be used in ELISA?
   • A list of our paired antibodies for use in ELISA for Reg1 can be found at the following link: Reg1 paired antibodies. For these pairs, H00005967-Q01 should be used as a standard.
2. I would like to know how many tests can be done from these antibodies?
   • These pairs are produced by a Taiwanese company called Abnova and we distribute for them. We do no in-house testing or development of their products. As is clearly listed on our datasheet, all of these antibody pairs utilize a biotinylated secondary antibody, so all are suitable for use with avidin peroxidase. It also states that Reagents are sufficient for at least 3-5 x 96 well plates using recommended protocols. Please see Abnova's recommended protocol.

Bioinformatics

• Gene Symbol: REG1A