RBP2 Antibody (3G12)

Images

 
Western Blot: RBP2 Antibody (3G12) [H00005948-M02] - Western Blot detection against Immunogen (36.01 KDa).
Western Blot: RBP2 Antibody (3G12) [H00005948-M02] - Analysis of RBP2 expression in transfected 293T cell line by RBP2 monoclonal antibody (M02), clone 3G12.Lane 1: RBP2 transfected lysate (Predicted MW: 15.7 KDa).Lane ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3G12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RBP2 Antibody (3G12) Summary

Immunogen
RBP2 (NP_004155.2, 45 a.a. - 134 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK
Specificity
RBP2 - retinol binding protein 2, cellular (3G12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RBP2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RBP2 Antibody (3G12)

  • Cellular retinol-binding protein II
  • cellular
  • CRABP-II
  • CRBP2CRBP-II
  • retinol binding protein 2, cellular

Background

RBP2 is an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. RBP2 may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-539
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fe, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NB110-40499
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-26616
Species: Hu
Applications: WB, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-58922
Species: Hu
Applications: WB
AF4146
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50444
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NB110-41487
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
NBP1-87695
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2590
Species: Hu
Applications: IP (-), WB, IHC-P
NBP2-47314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71701
Species: Hu, Mu
Applications: WB
NBP2-27073
Species: Hu, Mu, Bv, Eq, Op, Pm
Applications: WB, IHC-P

Publications for RBP2 Antibody (H00005948-M02) (0)

There are no publications for RBP2 Antibody (H00005948-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBP2 Antibody (H00005948-M02) (0)

There are no reviews for RBP2 Antibody (H00005948-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBP2 Antibody (H00005948-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBP2 Products

Bioinformatics Tool for RBP2 Antibody (H00005948-M02)

Discover related pathways, diseases and genes to RBP2 Antibody (H00005948-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBP2 Antibody (H00005948-M02)

Discover more about diseases related to RBP2 Antibody (H00005948-M02).
 

Pathways for RBP2 Antibody (H00005948-M02)

View related products by pathway.

PTMs for RBP2 Antibody (H00005948-M02)

Learn more about PTMs related to RBP2 Antibody (H00005948-M02).

Blogs on RBP2

There are no specific blogs for RBP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBP2 Antibody (3G12) and receive a gift card or discount.

Bioinformatics

Gene Symbol RBP2
Entrez
Uniprot