RB1CC1 Recombinant Protein Antigen

Images

 
There are currently no images for RB1CC1 Protein (NBP2-47312PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RB1CC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RB1CC1.

Source: E.coli

Amino Acid Sequence: QGWAAIMANLEDCSNSYQKLLFKFESIYSNYLQSIEDIKLKLTHLGTAVSVMAKIPLLECLTRHSYRECLGRLDSLPEHEDSEKAETKRSTELVLSP

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RB1CC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-47312.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for RB1CC1 Recombinant Protein Antigen

  • CC1
  • DRAGOU14
  • FIP200
  • KIAA0203200 kDa FAK family kinase-interacting protein
  • RB1-inducible coiled-coil 1
  • RB1-inducible coiled-coil protein 1
  • RBICC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP2-24738
Species: Hu, Mu, Mk
Applications: WB, IHC-P
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
NB100-240
Species: Hu, Rt
Applications: WB, IHC, IP, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-57525
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-29454
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-79711
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP
Applications: WB
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19127
Species: Hu
Applications: WB, ELISA, Flow
NBP2-46234
Species: Hu
Applications: WB, IHC
NBP2-47312PEP
Species: Hu
Applications: AC

Publications for RB1CC1 Protein (NBP2-47312PEP) (0)

There are no publications for RB1CC1 Protein (NBP2-47312PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RB1CC1 Protein (NBP2-47312PEP) (0)

There are no reviews for RB1CC1 Protein (NBP2-47312PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RB1CC1 Protein (NBP2-47312PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional RB1CC1 Products

Bioinformatics Tool for RB1CC1 Protein (NBP2-47312PEP)

Discover related pathways, diseases and genes to RB1CC1 Protein (NBP2-47312PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RB1CC1 Protein (NBP2-47312PEP)

Discover more about diseases related to RB1CC1 Protein (NBP2-47312PEP).
 

Pathways for RB1CC1 Protein (NBP2-47312PEP)

View related products by pathway.

PTMs for RB1CC1 Protein (NBP2-47312PEP)

Learn more about PTMs related to RB1CC1 Protein (NBP2-47312PEP).
 

Research Areas for RB1CC1 Protein (NBP2-47312PEP)

Find related products by research area.

Blogs on RB1CC1.

Autophagy independent roles of the core ATG proteins
By Christina Towers, PhD. Autophagy and ATG ProteinsAutophagy is a nutrient recycling process that cells use to fuel metabolism, particularly in response to nutrient deprivation.  It is critical for removal of dam...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RB1CC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RB1CC1