Rapsyn Recombinant Protein Antigen

Images

 
There are currently no images for Rapsyn Protein (NBP1-85537PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Rapsyn Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RAPSN.

Source: E.coli

Amino Acid Sequence: MECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVQALLGVAKCWVARKALDKALDAIE

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RAPSN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-85537.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Rapsyn Recombinant Protein Antigen

  • 43 kDa postsynaptic protein
  • Acetylcholine receptor-associated 43 kDa protein
  • CMS1D43 kDa receptor-associated protein of the synapse
  • CMS1EMGC3597
  • rapsyn
  • receptor-associated protein of the synapse
  • receptor-associated protein of the synapse, 43kD
  • RNF205RING finger protein 205

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF550
Species: Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP2-57262
Species: Hu
Applications: ICC/IF
AF562
Species: Rt
Applications: WB, Neut
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NB120-2804
Species: Hu, Mu, Rt, Am, Ch, Fi
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00006329-R01
Species: Hu
NBP1-79952
Species: Hu
Applications: WB
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84478
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85537PEP
Species: Hu
Applications: AC

Publications for Rapsyn Protein (NBP1-85537PEP) (0)

There are no publications for Rapsyn Protein (NBP1-85537PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rapsyn Protein (NBP1-85537PEP) (0)

There are no reviews for Rapsyn Protein (NBP1-85537PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Rapsyn Protein (NBP1-85537PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Rapsyn Products

Bioinformatics Tool for Rapsyn Protein (NBP1-85537PEP)

Discover related pathways, diseases and genes to Rapsyn Protein (NBP1-85537PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rapsyn Protein (NBP1-85537PEP)

Discover more about diseases related to Rapsyn Protein (NBP1-85537PEP).
 

Pathways for Rapsyn Protein (NBP1-85537PEP)

View related products by pathway.

Research Areas for Rapsyn Protein (NBP1-85537PEP)

Find related products by research area.

Blogs on Rapsyn

There are no specific blogs for Rapsyn, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Rapsyn Antibody
NBP1-85537

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Rapsyn Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RAPSN