RAMP1 Antibody (3B9) - Azide and BSA Free

Sandwich ELISA: RAMP1 Antibody (3B9) [H00010267-M04] - Detection limit for recombinant GST tagged RAMP1 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3B9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RAMP1 Antibody (3B9) - Azide and BSA Free Summary

• Immunogen: RAMP1 (NP_005846, 27 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGS
• Specificity: This product is specific for Human RAMP1 monoclonal antibody (M04), clone 3B9 [Gene ID: 10267].
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RAMP1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Mouse monoclonal antibody raised against a partial recombinant RAMP1.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAMP1 Antibody (3B9) - Azide and BSA Free

• calcitonin receptor-like receptor activity modifying protein 1
• Calcitonin-receptor-like receptor activity-modifying protein 1
• CRLR activity-modifying protein 1
• RAMP1
• receptor (calcitonin) activity modifying protein 1
• receptor (G protein-coupled) activity modifying protein 1
• receptor activity modifying protein 1
• receptor activity-modifying protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAMP1
• Uniprot:
  • NP_005846()