RAMP1 Antibody (1F1) - Azide and BSA Free

Sandwich ELISA: RAMP1 Antibody (1F1) [H00010267-M01] - Detection limit for recombinant GST tagged RAMP1 is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 1F1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RAMP1 Antibody (1F1) - Azide and BSA Free Summary

• Immunogen: RAMP1 (NP_005846, 27 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGS
• Specificity: RAMP1 - receptor (calcitonin) activity modifying protein 1
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RAMP1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAMP1 Antibody (1F1) - Azide and BSA Free

• calcitonin receptor-like receptor activity modifying protein 1
• Calcitonin-receptor-like receptor activity-modifying protein 1
• CRLR activity-modifying protein 1
• RAMP1
• receptor (calcitonin) activity modifying protein 1
• receptor (G protein-coupled) activity modifying protein 1
• receptor activity modifying protein 1
• receptor activity-modifying protein 1

Background

The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP1) protein, CRLR functions as a CGRP receptor. The RAMP1 protein is involved in the terminal glycosylation, maturation, and presentation of the CGRP receptor to the cell surface.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAMP1
• Entrez:
  • 10267(Human)
• OMIM:
  • 605153(Human)
• Uniprot:
  • NP_005846()