RAE1 Recombinant Protein Antigen

Images

 
There are currently no images for RAE1 Recombinant Protein Antigen (NBP2-58733PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RAE1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RAE1.

Source: E. coli

Amino Acid Sequence: VHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RAE1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58733.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RAE1 Recombinant Protein Antigen

  • dJ481F12.3
  • dJ800J21.1
  • FLJ30608
  • homolog of yeast Rae1 (Bharathi) mRNA-associated protein of 41 kDa (Kraemer)
  • MGC117333
  • MGC126076
  • MGC126077
  • MIG14
  • migration-inducing gene 14
  • Mnrp41
  • mRNA export factor
  • mRNA export protein
  • mRNA-associated protein mrnp 41
  • mRNA-binding protein, 41-kD
  • MRNP41
  • RAE1 (RNA export 1, S.pombe) homolog
  • Rae1 protein homolog
  • RAE1 RNA export 1 homolog (S. pombe)

Background

Mutations in the Schizosaccharomyces pombe Rae1 and Saccharomyces cerevisiae Gle2 genes have been shown to result in accumulation of poly(A)-containing mRNA in the nucleus, suggesting that the encoded proteins are involved in RNA export. The protein encoded by this gene is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31649
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB139
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
NBP3-48848
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-01346
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-90286
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-38014
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-52455
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-93325
Species: Hu
Applications: ICC/IF, IP, WB
NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
H00029107-M08
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP1-88517
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-760
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-83213
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-31407
Species: Hu, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-88706
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-38209
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-38806
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for RAE1 Recombinant Protein Antigen (NBP2-58733PEP) (0)

There are no publications for RAE1 Recombinant Protein Antigen (NBP2-58733PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAE1 Recombinant Protein Antigen (NBP2-58733PEP) (0)

There are no reviews for RAE1 Recombinant Protein Antigen (NBP2-58733PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RAE1 Recombinant Protein Antigen (NBP2-58733PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RAE1 Products

Blogs on RAE1

There are no specific blogs for RAE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RAE1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RAE1