Recombinant Human RABL2A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RABL2A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-229 of Human RABL2A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGKTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDIQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDADINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEVASPHS

Protein/Peptide Type
Recombinant Protein
Gene
RABL2A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RABL2A Protein

  • FLJ78724
  • MGC117180
  • RAB, member of RAS oncogene family-like 2A
  • rab-like protein 2A

Background

This gene is a member of the RAB gene family which belongs to the RAS GTPase superfamily. The proteins in the family of RAS-related signaling molecules are small GTP-binding proteins that play important roles in the regulation of exocytotic and endocytotic pathways. This gene maps to the site of an ancestral telomere fusion event and may be a subtelomeric gene. Two alternatively spliced transcript variants have been identified, both encoding the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84725
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13531
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27194
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87055
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88303
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00011158-T01
Species: Hu
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-86255
Species: Hu
Applications: IHC, IHC-P
NB100-1894
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
AF2746
Species: Hu, Mu
Applications: WB, ICC
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for RABL2A Recombinant Protein (H00011159-P01) (0)

There are no publications for RABL2A Recombinant Protein (H00011159-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RABL2A Recombinant Protein (H00011159-P01) (0)

There are no reviews for RABL2A Recombinant Protein (H00011159-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RABL2A Recombinant Protein (H00011159-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RABL2A Products

Bioinformatics Tool for RABL2A Recombinant Protein (H00011159-P01)

Discover related pathways, diseases and genes to RABL2A Recombinant Protein (H00011159-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RABL2A Recombinant Protein (H00011159-P01)

Discover more about diseases related to RABL2A Recombinant Protein (H00011159-P01).
 

Pathways for RABL2A Recombinant Protein (H00011159-P01)

View related products by pathway.

PTMs for RABL2A Recombinant Protein (H00011159-P01)

Learn more about PTMs related to RABL2A Recombinant Protein (H00011159-P01).
 

Research Areas for RABL2A Recombinant Protein (H00011159-P01)

Find related products by research area.

Blogs on RABL2A

There are no specific blogs for RABL2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GAP-43 Antibody
NB300-143

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RABL2A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RABL2A