Recombinant Human RABGGTB Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RABGGTB Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-331 of Human RABGGTB full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLMGQLHRMNREEILAFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDVNKVVEYVKGLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRNFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RABGGTB

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RABGGTB Protein

  • EC 2.5.1.60
  • Geranylgeranyl transferase type II subunit beta
  • geranylgeranyl transferase type-2 subunit beta
  • GGTase-II-beta
  • GGTB
  • Rab geranylgeranyltransferase subunit beta
  • Rab geranyl-geranyltransferase subunit beta
  • Rab geranylgeranyltransferase, beta subunit
  • Rab GG transferase beta
  • Rab GGTase beta
  • Type II protein geranyl-geranyltransferase subunit beta

Background

RABGGTB( AAH20790, 1 a.a. - 332 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86817
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-35006
Species: Hu
796-IC
Species: Mu
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for RABGGTB Recombinant Protein (H00005876-P01) (0)

There are no publications for RABGGTB Recombinant Protein (H00005876-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RABGGTB Recombinant Protein (H00005876-P01) (0)

There are no reviews for RABGGTB Recombinant Protein (H00005876-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RABGGTB Recombinant Protein (H00005876-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RABGGTB Products

Bioinformatics Tool for RABGGTB Recombinant Protein (H00005876-P01)

Discover related pathways, diseases and genes to RABGGTB Recombinant Protein (H00005876-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RABGGTB Recombinant Protein (H00005876-P01)

Discover more about diseases related to RABGGTB Recombinant Protein (H00005876-P01).
 

Pathways for RABGGTB Recombinant Protein (H00005876-P01)

View related products by pathway.

Blogs on RABGGTB

There are no specific blogs for RABGGTB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RABGGTB Antibody
NBP1-85962
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RABGGTB Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RABGGTB