![Western Blot: RAB6C Antibody [NBP1-74265] - HepG2 Cell Lysate 1ug/ml Gel Concentration 12%](http://images.novusbio.com/fullsize2/RAB6C-Antibody-Western-Blot-NBP1-74265-img0001.jpg "Western Blot: RAB6C Antibody [NBP1-74265] - HepG2 Cell Lysate 1ug/ml Gel Concentration 12%")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptides corresponding to the middle region of RAB6C.
Immunizing peptide sequence DVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLF. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAB6C |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This is a rabbit polyclonal antibody against RAB6C and was validated on Western blot. |
| Theoretical MW | 28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry-Paraffin: TBC1D9 Antibody [NBP2-13415] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/images2/TBC1D9-Antibody-Immunohistochemistry-Paraffin-NBP2-13415-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: TBC1D9 Antibody [NBP2-13415] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/images2/TBC1D9-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13415-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: RAB6A Antibody [NBP1-33110] - A549 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RAB6A protein stained by RAB6A antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.](http://images.novusbio.com/images2/RAB6A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-33110-img0007.jpg)
![Western Blot: RAB6A Antibody [NBP1-33110] - A. 30 ug A549 whole cell lysate/extract B. 30 ug H1299 whole cell lysate/extract C. 30 ug HCT116 whole cell lysate/extract 12 % SDS-PAGE RAB6A antibody dilution: 1:1000](http://images.novusbio.com/images2/RAB6A-Antibody-Western-Blot-NBP1-33110-img0011.jpg)
![Knockout Validated: RAB6A Antibody [NBP1-33110] - Wild-type (WT) and RAB6A knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RAB6A antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.](http://images.novusbio.com/images2/RAB6A-Antibody-Western-Blot-NBP1-33110-img0014.jpg)
![Immunohistochemistry-Paraffin: MDR1/ABCB1 Antibody (SN06-42) [NBP2-67667] - Analysis of paraffin-embedded human liver tissue using anti-P Glycoprotein antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/MDR1-ABCB1-Antibody-(SN06-42)-Immunohistochemistry-Paraffin-NBP2-67667-img0001.jpg)
![Immunohistochemistry-Frozen: MDR1/ABCB1 Antibody (SN06-42) [NBP2-67667] - Mouse (B6) liver tissue. Fixed in ice-cold methanol for 10 minutes. Blocking in 10% serum and 1% BSA. Primary antibody at 5 ug/mL, overnight incubation. Secondary antibody at 2 ug/mL for 1.5 hour (Invitrogen A-11012). Mounting with Vector Vectashield with DAPI. Image from a verified customer review.](http://images.novusbio.com/images2/MDR1-ABCB1-Antibody-(SN06-42)-Immunohistochemistry-Frozen-NBP2-67667-img0004.jpg)
![Immunohistochemistry-Paraffin: MDR1/ABCB1 Antibody (SN06-42) [NBP2-67667] - Analysis of paraffin-embedded mouse kidney tissue using anti-P Glycoprotein antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/MDR1-ABCB1-Antibody-(SN06-42)-Immunohistochemistry-Paraffin-NBP2-67667-img0003.jpg)
![Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.](http://images.novusbio.com/images2/p53-Antibody-(PAb-240)-Flow-Cytometry-NB200-103-img0006.jpg)
![Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.](http://images.novusbio.com/images2/p53-Antibody-(PAb-240)-Flow-Cytometry-NB200-103-img0007.jpg)
![Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.](http://images.novusbio.com/images2/p53-Antibody-(PAb-240)-Flow-(Intracellular)-NB200-103-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: HIV-1 Rev binding protein Antibody [NBP1-91991] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.](http://images.novusbio.com/images2/HIV-1-Rev-binding-protein-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91991-img0009.jpg)
![Western Blot: HIV-1 Rev binding protein Antibody [NBP1-91991] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/images2/HIV-1-Rev-binding-protein-Antibody-Western-Blot-NBP1-91991-img0010.jpg)
![Immunohistochemistry-Paraffin: HIV-1 Rev binding protein Antibody [NBP1-91991] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.](http://images.novusbio.com/images2/HIV-1 Rev binding protein Antibody-Immunohistochemistry-Paraffin-NBP1-91991-img0012.jpg)
![Immunocytochemistry/Immunofluorescence: Prohibitin 2 Antibody [NBP2-13754] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/images2/Prohibitin-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13754-img0007.jpg)
![Immunohistochemistry-Paraffin: Prohibitin 2 Antibody [NBP2-13754] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/Prohibitin-2-Antibody-Immunohistochemistry-Paraffin-NBP2-13754-img0008.jpg)
![Immunohistochemistry-Paraffin: Prohibitin 2 Antibody [NBP2-13754] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/Prohibitin-2-Antibody-Immunohistochemistry-Paraffin-NBP2-13754-img0009.jpg)
![Western Blot: PRRT2 Antibody [NBP2-82026] - Analysis of PRRT2 in mouse brain tissue lysate with PRRT2 antibody at 1 ug/ml.](http://images.novusbio.com/images2/PRRT2-Antibody-Western-Blot-NBP2-82026-img0001.jpg)
![Immunohistochemistry: PRRT2 Antibody [NBP2-82026] - Immunohistochemistry of PRRT2 in rat brain tissue with PRRT2 antibody at 2.5 ug/ml.](http://images.novusbio.com/images2/PRRT2-Antibody-Immunohistochemistry-NBP2-82026-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: PRRT2 Antibody [NBP2-82026] - Immunofluorescence of PRRT2 in rat brain tissue with PRRT2 antibody at 20 ug/ml.](http://images.novusbio.com/images2/PRRT2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-82026-img0003.jpg)
![Western Blot: CNTLN Antibody [NBP1-88795] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://images.novusbio.com/images2/CNTLN-Antibody-Western-Blot-NBP1-88795-img0005.jpg)
![Immunohistochemistry-Paraffin: CNTLN Antibody [NBP1-88795] - Staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.](http://images.novusbio.com/images2/CNTLN-Antibody-Immunohistochemistry-Paraffin-NBP1-88795-img0002.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for RAB6C Antibody (NBP1-74265)Discover more about diseases related to RAB6C Antibody (NBP1-74265).
| Pathways for RAB6C Antibody (NBP1-74265)View related products by pathway.
|
PTMs for RAB6C Antibody (NBP1-74265)Learn more about PTMs related to RAB6C Antibody (NBP1-74265).
| Research Areas for RAB6C Antibody (NBP1-74265)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: DCTN3 Antibody [NBP1-52105] - Staining (8ug/ml) of paraffin embedded Human Kidney. Heat induced antigen retrieval with citrate buffer pH 6, HRP-Staining.](http://images.novusbio.com/images2/DCTN3-Antibody-Immunohistochemistry-Paraffin-NBP1-52105-img0003.jpg)
![Immunohistochemistry-Paraffin: DCTN3 Antibody [NBP1-52105] - Negative Control showing staining of paraffin embedded Human Kidney, with no primary antibody.](http://images.novusbio.com/images2/DCTN3-Antibody-Immunohistochemistry-Paraffin-NBP1-52105-img0004.jpg)
![Western Blot: DCTN3 Antibody [NBP1-52105] - Staining (0.2ug/ml) of Mouse (A) and Rat (B) Skeletal Muscle lysates (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.](http://images.novusbio.com/images2/DCTN3-Antibody-Western-Blot-NBP1-52105-img0006.jpg)
![Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/images2/DYNC1H1-Antibody-Immunohistochemistry-Paraffin-NBP1-84254-img0004.jpg)
![Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/images2/DYNC1H1-Antibody-Immunohistochemistry-Paraffin-NBP1-84254-img0005.jpg)
![Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining in human cerebral cortex and pancreas tissues using anti-DYNC1H1 antibody. Corresponding DYNC1H1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/DYNC1H1-Antibody-Immunohistochemistry-Paraffin-NBP1-84254-img0006.jpg)
![Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.](http://images.novusbio.com/images2/Calcium-binding-protein-P22-Antibody-Immunohistochemistry-Paraffin-NBP1-33736-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.](http://images.novusbio.com/images2/Calcium-binding-protein-P22-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-33736-img0009.jpg)
![Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded SW480 xenograft, using antibody at 1:100 dilution.](http://images.novusbio.com/images2/Calcium-binding-protein-P22-Antibody-Immunohistochemistry-Paraffin-NBP1-33736-img0003.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](http://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")