![Western Blot: RAB6C Antibody [NBP1-74265] - HepG2 Cell Lysate 1ug/ml Gel Concentration 12%](http://images.novusbio.com/fullsize2/RAB6C-Antibody-Western-Blot-NBP1-74265-img0001.jpg "Western Blot: RAB6C Antibody [NBP1-74265] - HepG2 Cell Lysate 1ug/ml Gel Concentration 12%")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptides corresponding to the middle region of RAB6C.
Immunizing peptide sequence DVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLF. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAB6C |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This is a rabbit polyclonal antibody against RAB6C and was validated on Western blot. |
| Theoretical MW | 28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for RAB6C Antibody (NBP1-74265)Discover more about diseases related to RAB6C Antibody (NBP1-74265).
| Pathways for RAB6C Antibody (NBP1-74265)View related products by pathway.
|
PTMs for RAB6C Antibody (NBP1-74265)Learn more about PTMs related to RAB6C Antibody (NBP1-74265).
| Research Areas for RAB6C Antibody (NBP1-74265)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: TBC1D9 Antibody [NBP2-13415] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/fullsize2/TBC1D9-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13415-img0003.jpg)
![Immunohistochemistry-Paraffin: TBC1D9 Antibody [NBP2-13415] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize2/TBC1D9 Antibody-Immunohistochemistry-Paraffin-NBP2-13415-img0004.jpg)
![Western Blot: RAB6A Antibody [NBP1-33110] - Wild-type (WT) and RAB6A knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RAB6A antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.](http://images.novusbio.com/fullsize2/RAB6A-Antibody-Western-Blot-NBP1-33110-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: RAB6A Antibody [NBP1-33110] - A549 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RAB6A protein stained by RAB6A antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.](http://images.novusbio.com/fullsize2/RAB6A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-33110-img0007.jpg)
![Immunohistochemistry-Paraffin: RAB6A Antibody [NBP1-33110] - Paraffin-embedded MDA-MB-468 xenograft, using antibody at 1:500 dilution.](http://images.novusbio.com/fullsize2/RAB6A Antibody-Immunohistochemistry-Paraffin-NBP1-33110-img0005.jpg)
![Western Blot: MDR1/ABCB1 Antibody [NB100-80870] - Analyis of anti-ABCB1 antibody shows detection of ABCB1 in crude membrane extracts from HF insect cells over-expressing human ABCB1. The extract was loaded onto a gel in the amounts indicated followed by electrophoresis and transfer to nitrocellulose. The membrane was probed with the primary antibody diluted to 1:600, followed by Peroxidase Conjugated Affinity Purified Anti-RABBIT IgG at 1:10000. Personal Communication, Anna Calcagno, CCR-NCI, Bethesda, MD.](http://images.novusbio.com/fullsize2/MDR1-ABCB1-Antibody-Western-Blot-NB100-80870-img0002.jpg)
![Immunohistochemistry-Paraffin: MDR1/ABCB1 Antibody [NB100-80870] - Staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.](http://images.novusbio.com/fullsize2/MDR1-ABCB1-Antibody-Immunohistochemistry-Paraffin-NB100-80870-img0003.jpg)
![Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.](http://images.novusbio.com/fullsize2/p53-Antibody-(PAb-240)-Western-Blot-NB200-103-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/fullsize2/p53-Antibody-(PAb-240)-Immunocytochemistry-Immunofluorescence-NB200-103-img0004.jpg)
![Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.](http://images.novusbio.com/fullsize2/p53-Antibody-(PAb-240)-Immunohistochemistry-Paraffin-NB200-103-img0005.jpg)
![Western Blot: DCTN3 Antibody [NBP1-91823] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/DCTN3-Antibody-Western-Blot-NBP1-91823-img0004.jpg)
![Immunohistochemistry-Paraffin: DCTN3 Antibody [NBP1-91823] - Staining of human pancreas shows distinct cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize2/DCTN3-Antibody-Immunohistochemistry-Paraffin-NBP1-91823-img0002.jpg)
![Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize2/DYNC1H1-Antibody-Immunohistochemistry-Paraffin-NBP1-84254-img0005.jpg)
![Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize2/DYNC1H1-Antibody-Immunohistochemistry-Paraffin-NBP1-84254-img0004.jpg)
![Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining in human cerebral cortex and pancreas tissues using anti-DYNC1H1 antibody. Corresponding DYNC1H1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/DYNC1H1 Antibody-Immunohistochemistry-Paraffin-NBP1-84254-img0006.jpg)
![Western Blot: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/HIV-1-Rev-binding-protein-(HRB)-Antibody-Western-Blot-NBP1-91991-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.](http://images.novusbio.com/fullsize2/HIV-1 Rev binding protein (HRB) Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91991-img0007.jpg)
![Immunohistochemistry-Paraffin: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize2/HIV-1-Rev-binding-protein-(HRB)-Antibody-Immunohistochemistry-Paraffin-NBP1-91991-img0001.jpg)
![Western Blot: Calcium-binding-protein-P22 Antibody [NBP1-33736] - A. 50 ug mouse liver lysate/extract 12 % SDS-PAGE](http://images.novusbio.com/fullsize2/Calcium-binding-protein-P22-Antibody-Western-Blot-NBP1-33736-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.](http://images.novusbio.com/fullsize2/Calcium-binding-protein-P22-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-33736-img0009.jpg)
![Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.](http://images.novusbio.com/fullsize2/Calcium-binding-protein-P22-Antibody-Immunohistochemistry-Paraffin-NBP1-33736-img0007.jpg)
![Western Blot: Prohibitin 2 Antibody [NBP1-33463] - Sample (30 ug of whole cell lysate) A: H1299 B: Hela 10% SDS PAGE; antibody diluted at 1:1000.](http://images.novusbio.com/fullsize2/Prohibitin 2 Antibody-Western Blot-NBP1-33463-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: Prohibitin 2 Antibody [NBP1-33463] - Analysis of paraformaldehyde-fixed A431, using REA (NBP1-33463) antibody at 1:200 dilution.](http://images.novusbio.com/fullsize2/Prohibitin 2 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-33463-img0004.jpg)
![Immunohistochemistry-Paraffin: Prohibitin 2 Antibody [NBP1-33463] - Paraffin-embedded mouse urinary bladder. Prohibitin 2 antibody diluted at 1:500.](http://images.novusbio.com/fullsize2/Prohibitin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-33463-img0008.jpg)
![Immunohistochemistry-Paraffin: PRRT2 Antibody [NBP1-84168] - Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil.](http://images.novusbio.com/fullsize2/PRRT2-Antibody-Immunohistochemistry-Paraffin-NBP1-84168-img0011.jpg)
![Immunohistochemistry-Paraffin: PRRT2 Antibody [NBP1-84168] - Immunohistochemical staining of human cerebellum shows strong positivity in neuropil.](http://images.novusbio.com/fullsize2/PRRT2-Antibody-Immunohistochemistry-Paraffin-NBP1-84168-img0009.jpg)
![Immunohistochemistry-Paraffin: PRRT2 Antibody [NBP1-84168] - Immunohistochemical staining of human pancreas shows no positivity as expected.](http://images.novusbio.com/fullsize2/PRRT2-Antibody-Immunohistochemistry-Paraffin-NBP1-84168-img0010.jpg)
![Western Blot: CNTLN Antibody [NBP1-88795] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://images.novusbio.com/fullsize2/CNTLN Antibody-Western Blot-NBP1-88795-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: CNTLN Antibody [NBP1-88795] - Staining of human cell line U-251 MG shows positivity in mitochondria and centrosome.](http://images.novusbio.com/fullsize2/CNTLN-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88795-img0004.jpg)
![Immunohistochemistry-Paraffin: CNTLN Antibody [NBP1-88795] - Staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.](http://images.novusbio.com/fullsize2/CNTLN-Antibody-Immunohistochemistry-Paraffin-NBP1-88795-img0002.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0005.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.")
![Western Blot: RAB6C Overexpression Lysate (Adult Normal) [NBP2-06078] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for RAB6C.](http://images.novusbio.com/images/RAB6C Overexpression Lysate (Adult Normal)-Western Blot-NBP2-06078-img0001.jpg "Western Blot: RAB6C Overexpression Lysate (Adult Normal) [NBP2-06078] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for RAB6C.")