RAB6C Antibody

Images

 
Western Blot: RAB6C Antibody [NBP1-74265] - HepG2 Cell Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB6C Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of RAB6C. Immunizing peptide sequence DVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB6C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RAB6C and was validated on Western blot.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RAB6C Antibody

  • RAB6C, member RAS oncogene family
  • ras-related protein Rab-6C
  • WTH3Rab6-like protein WTH3

Background

The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-74265
Species: Hu
Applications: WB

Publications for RAB6C Antibody (NBP1-74265) (0)

There are no publications for RAB6C Antibody (NBP1-74265).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB6C Antibody (NBP1-74265) (0)

There are no reviews for RAB6C Antibody (NBP1-74265). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB6C Antibody (NBP1-74265) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB6C Products

Bioinformatics Tool for RAB6C Antibody (NBP1-74265)

Discover related pathways, diseases and genes to RAB6C Antibody (NBP1-74265). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB6C Antibody (NBP1-74265)

Discover more about diseases related to RAB6C Antibody (NBP1-74265).
 

Pathways for RAB6C Antibody (NBP1-74265)

View related products by pathway.

PTMs for RAB6C Antibody (NBP1-74265)

Learn more about PTMs related to RAB6C Antibody (NBP1-74265).
 

Research Areas for RAB6C Antibody (NBP1-74265)

Find related products by research area.

Blogs on RAB6C

There are no specific blogs for RAB6C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB6C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB6C
Uniprot