RAB27B Antibody

Images

 
Western Blot: RAB27B Antibody [H00005874-D01P] - Analysis of RAB27B expression in human spleen.
Western Blot: RAB27B Antibody [H00005874-D01P] - Analysis of RAB27B expression in HeLa.
Western Blot: RAB27B Antibody [H00005874-D01P] - Analysis of RAB27B expression in transfected 293T cell line by RAB27B polyclonal antibody.Lane 1: RAB27B transfected lysate(24.09 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB27B Antibody Summary

Immunogen
RAB27B (AAH27474.1, 1 a.a. - 218 a.a.) full-length human protein. MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRSWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB27B
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB27B Antibody

  • C25KG
  • RAB27B, member RAS oncogene family
  • ras-related protein Rab-27B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005873-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NB300-943
Species: Mu
Applications: WB, ICC/IF, IHC-P, PEP-ELISA
NBP1-86176
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1278
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92156
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
32190002
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-56973
Species: Hu
Applications: WB, ICC/IF
NB100-41385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
NBP1-84764
Species: Hu
Applications: IHC, IHC-P
MAB8528
Species: Hu
Applications: Flow, CyTOF-ready
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for RAB27B Antibody (H00005874-D01P) (0)

There are no publications for RAB27B Antibody (H00005874-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB27B Antibody (H00005874-D01P) (0)

There are no reviews for RAB27B Antibody (H00005874-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB27B Antibody (H00005874-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB27B Products

Bioinformatics Tool for RAB27B Antibody (H00005874-D01P)

Discover related pathways, diseases and genes to RAB27B Antibody (H00005874-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB27B Antibody (H00005874-D01P)

Discover more about diseases related to RAB27B Antibody (H00005874-D01P).
 

Pathways for RAB27B Antibody (H00005874-D01P)

View related products by pathway.

PTMs for RAB27B Antibody (H00005874-D01P)

Learn more about PTMs related to RAB27B Antibody (H00005874-D01P).
 

Research Areas for RAB27B Antibody (H00005874-D01P)

Find related products by research area.

Blogs on RAB27B

There are no specific blogs for RAB27B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB27B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB27B
Uniprot