QTRTD1 Antibody

Images

 
Immunohistochemistry: QTRTD1 Antibody [NBP2-32674] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells
Immunohistochemistry: QTRTD1 Antibody [NBP2-32674] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

QTRTD1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FIGMPESLLYCSLHDPVSPCPAGYVTNKSVSVWSVAGRVEMTVSKFMAIQKALQPDWFQCLSDGEVSCKEATS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
QTRTD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
QTRTD1 Protein (NBP2-32674PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for QTRTD1 Antibody

  • EC 2.4.2.29
  • FLJ12960
  • queuine tRNA-ribosyltransferase domain containing 1
  • Queuine tRNA-ribosyltransferase domain-containing protein 1
  • queuine tRNA-ribosyltransferase subunit QTRTD1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20030
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
H00009097-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for QTRTD1 Antibody (NBP2-32674) (0)

There are no publications for QTRTD1 Antibody (NBP2-32674).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for QTRTD1 Antibody (NBP2-32674) (0)

There are no reviews for QTRTD1 Antibody (NBP2-32674). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for QTRTD1 Antibody (NBP2-32674) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional QTRTD1 Products

Bioinformatics Tool for QTRTD1 Antibody (NBP2-32674)

Discover related pathways, diseases and genes to QTRTD1 Antibody (NBP2-32674). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on QTRTD1

There are no specific blogs for QTRTD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our QTRTD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol QTRTD1