Recombinant Human PTGIR Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PTGIR Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 296-386 of Human PTGIR partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PTGIR
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PTGIR Protein

  • IP
  • MGC102830
  • PGI receptor
  • PGI2 receptor
  • PRIPR
  • prostacyclin receptor
  • prostaglandin I2 (prostacyclin) receptor (IP)
  • Prostaglandin I2 receptor
  • Prostanoid IP receptor
  • PTGIR

Background

PTGIR - prostaglandin I2 (prostacyclin) receptor (IP)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-84833
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NLS1049
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
MAB6656
Species: Hu
Applications: WB, IHC
AF2667
Species: Hu
Applications: WB, IHC
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84835
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
NBP2-38648
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7788
Species: Hu
Applications: WB, Simple Western

Publications for PTGIR Partial Recombinant Protein (H00005739-Q01) (0)

There are no publications for PTGIR Partial Recombinant Protein (H00005739-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTGIR Partial Recombinant Protein (H00005739-Q01) (0)

There are no reviews for PTGIR Partial Recombinant Protein (H00005739-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTGIR Partial Recombinant Protein (H00005739-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PTGIR Products

Bioinformatics Tool for PTGIR Partial Recombinant Protein (H00005739-Q01)

Discover related pathways, diseases and genes to PTGIR Partial Recombinant Protein (H00005739-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTGIR Partial Recombinant Protein (H00005739-Q01)

Discover more about diseases related to PTGIR Partial Recombinant Protein (H00005739-Q01).
 

Pathways for PTGIR Partial Recombinant Protein (H00005739-Q01)

View related products by pathway.

PTMs for PTGIR Partial Recombinant Protein (H00005739-Q01)

Learn more about PTMs related to PTGIR Partial Recombinant Protein (H00005739-Q01).
 

Research Areas for PTGIR Partial Recombinant Protein (H00005739-Q01)

Find related products by research area.

Blogs on PTGIR

There are no specific blogs for PTGIR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PTGIR Antibody (4B10)
H00005739-M01
COX-2 Antibody
NB100-689

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PTGIR Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PTGIR
Entrez