PTGER3 Recombinant Protein Antigen

Images

 
There are currently no images for PTGER3 Protein (NBP1-84835PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PTGER3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTGER3.

Source: E. coli

Amino Acid Sequence: MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTGER3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84835.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PTGER3 Recombinant Protein Antigen

  • EP3
  • EP3EP3e
  • EP3-I
  • EP3-II
  • EP3-III
  • EP3-IV
  • MGC141828
  • MGC141829
  • MGC27302
  • PGE receptor EP3 subtype
  • PGE receptor, EP3 subtype
  • PGE2 receptor EP3 subtype
  • PGE2-R
  • prostaglandin E receotor EP3 subtype 3 isoform
  • prostaglandin E receptor 3 (subtype EP3)
  • prostaglandin E2 receptor EP3 subtype
  • prostaglandin receptor (PGE-2)
  • Prostanoid EP3 receptor
  • PTGER3

Background

Prostaglandin E Receptor EP3 is a member of the G protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Prostaglandin E2 Receptor EP3 expression has been documented throughout the periphery, especially kidney. ESTs have been isolated primarily from kidney libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS3890
Species: Bv, Hu, Pm, Pm
Applications: IHC,  IHC-P
NBP3-16740
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MEP00B
Species: Mu
Applications: ELISA
NBP2-92856
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NLS1049
Species: Eq, Hu, Pm, Po, Pm
Applications: ICC, ICC/IF, IHC,  IHC-P
NBP3-13522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00005729-B01P
Species: Hu
Applications: Flow, ICC/IF, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-85500
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-47534
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-32550
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-84835PEP
Species: Hu
Applications: AC

Publications for PTGER3 Protein (NBP1-84835PEP) (0)

There are no publications for PTGER3 Protein (NBP1-84835PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTGER3 Protein (NBP1-84835PEP) (0)

There are no reviews for PTGER3 Protein (NBP1-84835PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PTGER3 Protein (NBP1-84835PEP). (Showing 1 - 1 of 1 FAQ).

  1. I received an e-mail about some complimentary antibody samples that are available. We work with Ptger3 and have tried several antibodies (Santa Cruz, Abcam, Cayman) but haven't found an antibody that works. I was wondering if you would be willing to send us a complimentary sample of your Ptger3 antibody to test? If it works, we will likely buy a decent amount.
    • A list of our Ptger3 antibodies can be found here. It is company policy that we do not give out free samples as we have a 100% guarantee on all of our products for the applications and species listed on the datasheet. The email you received about free samples only applies to the antibodies listed in the email, of which Ptger3 is not listed.

Additional PTGER3 Products

Research Areas for PTGER3 Protein (NBP1-84835PEP)

Find related products by research area.

Blogs on PTGER3

There are no specific blogs for PTGER3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PTGER3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PTGER3