PTGER3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PTGER3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTGER3.
  
  

  Source: E. coli

  Amino Acid Sequence: MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PTGER3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84835.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PTGER3 Recombinant Protein Antigen

• EP3
• EP3EP3e
• EP3-I
• EP3-II
• EP3-III
• EP3-IV
• MGC141828
• MGC141829
• MGC27302
• PGE receptor EP3 subtype
• PGE receptor, EP3 subtype
• PGE2 receptor EP3 subtype
• PGE2-R
• prostaglandin E receotor EP3 subtype 3 isoform
• prostaglandin E receptor 3 (subtype EP3)
• prostaglandin E2 receptor EP3 subtype
• prostaglandin receptor (PGE-2)
• Prostanoid EP3 receptor
• PTGER3

Background

Prostaglandin E Receptor EP3 is a member of the G protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Prostaglandin E2 Receptor EP3 expression has been documented throughout the periphery, especially kidney. ESTs have been isolated primarily from kidney libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for PTGER3 Protein (NBP1-84835PEP). (Showing 1 - 1 of 1 FAQ).

1. I received an e-mail about some complimentary antibody samples that are available. We work with Ptger3 and have tried several antibodies (Santa Cruz, Abcam, Cayman) but haven't found an antibody that works. I was wondering if you would be willing to send us a complimentary sample of your Ptger3 antibody to test? If it works, we will likely buy a decent amount.
   • A list of our Ptger3 antibodies can be found here. It is company policy that we do not give out free samples as we have a 100% guarantee on all of our products for the applications and species listed on the datasheet. The email you received about free samples only applies to the antibodies listed in the email, of which Ptger3 is not listed.

Bioinformatics

• Gene Symbol: PTGER3