PTGER2 Antibody

Western Blot: PTGER2 Antibody [H00005732-D01P] - Analysis of PTGER2 expression in transfected 293T cell line by PTGER2 polyclonal antibody.Lane 1: PTGER2 transfected lysate(39.80 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

PTGER2 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: PTGER2 (NP_000947.2, 1 a.a. - 358 a.a.) full-length human protein. MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
• Specificity: Reacts with prostaglandin E receptor 2 (subtype EP2), 53kDa.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTGER2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTGER2 Antibody

• EP2
• PGE receptor EP2 subtype
• PGE2 receptor EP2 subtype
• prostaglandin E receptor 2 (subtype EP2), 53kD
• prostaglandin E receptor 2 (subtype EP2), 53kDa
• prostaglandin E2 receptor EP2 subtype
• Prostanoid EP2 receptor
• PTGER2

Background

Prostaglandin E2, a member of the autacoid family of lipid mediators, is a major renal cyclooxygenase product of arachidonic acid metabolism.Prostaglandin E2 binds to four G protein-coupled E-prostanoid receptors,designated EP1, EP2, EP3 and EP4. The expression and function of the prostaglandin E2 receptors have been highly characterized in kidney. EP1,which is predominantly expressed in the collecting duct, couples to Gq proteins to inhibit sodium absorption and increase in intracellular calcium, which act as second messengers. EP2 is coupled to Gs proteins, which stimulate adenylyl cyclase. EP2 has the lowest expression in kidney, but EP2 knockout mice exhibit salt-sensitive hypertension, which suggests a role for EP2 in salt excretion. EP3 is expressed in renal vessels, thick ascending limb and collecting duct. EP3 has at least 6 alternative splice variants that couple to Gi proteins to inhibit cAMP, which subsequently inhibit sodium and water transport. In uterus, EP3 induces the contraction of uterine smooth muscles.EP4 is expressed in glomerulus and collecting duct. It couples to Gs proteins,which stimulate adenylyl cyclase and regulate glomerular tone and renal renin release.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTGER2
• Entrez:
  • 5732(Human)
• Uniprot:
  • NP_000947.2(Human)