PTCD1 Antibody

Images

 
Orthogonal Strategies: Western Blot: PTCD1 Antibody [NBP1-81493] - Analysis in human cell lines Caco-2 and A-431. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Immunohistochemistry: PTCD1 Antibody [NBP1-81493] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Western Blot: PTCD1 Antibody [NBP1-81493] - Analysis in human cell line CACO-2.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

PTCD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PVELEVNLLTPGAVPPTVVSFGTVTTPADRLALIGGLEGFLSKMAEHRQQPDIRTLTLLAEVVESGSPAESLLLALLDEHQVEADLTFFNTLVRKKSKLGDLE
Specificity
Specificity of human PTCD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTCD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PTCD1 Protein (NBP1-81493PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PTCD1 Antibody

  • KIAA0632pentatricopeptide repeat-containing protein 1
  • pentatricopeptide repeat domain 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84620
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-26176
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-32744
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13619
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-84125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45938
Species: Hu
Applications: WB, Flow, IHC, IF
NBP1-83654
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-19436
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81493
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PTCD1 Antibody (NBP1-81493) (0)

There are no publications for PTCD1 Antibody (NBP1-81493).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTCD1 Antibody (NBP1-81493) (0)

There are no reviews for PTCD1 Antibody (NBP1-81493). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PTCD1 Antibody (NBP1-81493) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PTCD1 Antibody (NBP1-81493)

Discover related pathways, diseases and genes to PTCD1 Antibody (NBP1-81493). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTCD1 Antibody (NBP1-81493)

Discover more about diseases related to PTCD1 Antibody (NBP1-81493).
 

Pathways for PTCD1 Antibody (NBP1-81493)

View related products by pathway.

Blogs on PTCD1

There are no specific blogs for PTCD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTCD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTCD1