PSMB5 Recombinant Protein Antigen

Images

 
There are currently no images for PSMB5 Recombinant Protein Antigen (NBP2-57323PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PSMB5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PSMB5.

Source: E. coli

Amino Acid Sequence: LASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PSMB5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57323.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PSMB5 Recombinant Protein Antigen

  • LMPX
  • LMPXproteasome beta 5 subunit
  • Macropain epsilon chain
  • MB1
  • MB1EC 3.4.25.1
  • Multicatalytic endopeptidase complex epsilon chain
  • proteasome (prosome, macropain) subunit, beta type, 5
  • proteasome catalytic subunit 3
  • Proteasome chain 6
  • Proteasome epsilon chain
  • proteasome subunit beta type-5
  • Proteasome subunit MB1
  • Proteasome subunit X
  • proteasome subunit, beta type, 5
  • PSMB5
  • PSX large multifunctional protease X
  • XMGC104214

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit in the proteasome. This catalytic subunit is not present in the immunoproteasome and is replaced by catalytic subunit 3i (proteasome beta 8 subunit).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005696-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-01817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB600-1160
Species: Bv, Ca, Hu, Mu, Po, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP1-28912
Species: Rt
Applications: PEP-ELISA, WB
H00004499-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00004496-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBL1-13348
Species: Hu
Applications: WB
NBP2-10437
Species: Hu
Applications: WB
H00004489-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00004494-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00004495-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00004493-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB600-717
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
NBP1-88660
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-94869
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF5329
Species: Hu
Applications: IHC, KO, WB
NBP1-87349
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-57323PEP
Species: Hu
Applications: AC

Publications for PSMB5 Recombinant Protein Antigen (NBP2-57323PEP) (0)

There are no publications for PSMB5 Recombinant Protein Antigen (NBP2-57323PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMB5 Recombinant Protein Antigen (NBP2-57323PEP) (0)

There are no reviews for PSMB5 Recombinant Protein Antigen (NBP2-57323PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PSMB5 Recombinant Protein Antigen (NBP2-57323PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PSMB5 Products

Research Areas for PSMB5 Recombinant Protein Antigen (NBP2-57323PEP)

Find related products by research area.

Blogs on PSMB5

There are no specific blogs for PSMB5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PSMB5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMB5