PRR11 Antibody

Images

 
Western Blot: PRR11 Antibody [NBP1-83784] - Analysis in human cell lines U2OS and SK-MEL-30 using Anti-PRR11 antibody. Corresponding PRR11 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Immunohistochemistry-Paraffin: PRR11 Antibody [NBP1-83784] - Staining of human nasopharynx shows strong cytoplasmic positivity in respiratory epithelial cells.
Western Blot: PRR11 Antibody [NBP1-83784] - Analysis in human cell line A-549.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRR11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LAPVLLRKPSLAKALQAGPLKKDGPMQITVKDLLTVKLKKTQSLDEKRKLIPSPKARNPLVTVSDLQHVTLKPNSKVLSTR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRR11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRR11 Protein (NBP1-83784PEP)
Publications
Read Publications using
NBP1-83784 in the following applications:

  • IHC
    2 publications
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25971332).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRR11 Antibody

  • FLJ11029
  • proline rich 11
  • proline-rich protein 11
  • transcription repressor of MHCII

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
PP-H7431-00
Species: Hu
Applications: WB
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP1-86649
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PRR11 Antibody (NBP1-83784)(3)

Reviews for PRR11 Antibody (NBP1-83784) (0)

There are no reviews for PRR11 Antibody (NBP1-83784). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRR11 Antibody (NBP1-83784) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRR11 Products

Bioinformatics Tool for PRR11 Antibody (NBP1-83784)

Discover related pathways, diseases and genes to PRR11 Antibody (NBP1-83784). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PRR11

There are no specific blogs for PRR11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRR11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRR11