Protocadherin-12 Antibody (NBP1-59205)

Images

 
Western Blot: Protocadherin 12 Antibody [NBP1-59205] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Protocadherin-12 Antibody Summary

Immunogen
Synthetic peptides corresponding to PCDH12(protocadherin 12) The peptide sequence was selected from the middle region of PCDH12. Peptide sequence SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCDH12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PCDH12 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Protocadherin-12 Antibody

  • PCDH12
  • protocadherin 12
  • Protocadherin12
  • Protocadherin-12
  • Vascular cadherin-2
  • vascular endothelial cadherin 2
  • Vascular endothelial cadherin-2
  • VECAD2
  • VE-cad-2
  • VE-cadherin 2
  • VE-cadherin-2
  • VE-cadherin-2protocadherin-12

Background

PCDH12 belongs to the protocadherin protein family, a subfamily of the cadherin superfamily. It consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The function of this cellular adhesion protein is undetermined but mouse protocadherin 12 does not bind catenins and appears to have no affect on cell migration or growth.This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The encoded protein consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The gene localizes to the region on chromosome 5 where the protocadherin gene clusters reside. The exon organization of this transcript is similar to that of the gene cluster transcripts, notably the first large exon, but no significant sequence homology exists. The function of this cellular adhesion protein is undetermined but mouse protocadherin 12 does not bind catenins and appears to have no affect on cell migration or growth.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53235
Species: Hu
Applications: Flow, ICC/IF, IHC-P
NBP1-81410
Species: Hu
Applications: IHC, IHC-P
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-49512
Species: Hu
Applications: IHC
NB100-2693
Species: Dr
Applications: WB, ELISA, ICC/IF, IHC
MAB7278
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-82120
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF761
Species: Mu
Applications: WB, Simple Western, Flow, IHC, AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2240
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
MAB8626
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-59205
Species: Hu
Applications: WB

Publications for Protocadherin-12 Antibody (NBP1-59205) (0)

There are no publications for Protocadherin-12 Antibody (NBP1-59205).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protocadherin-12 Antibody (NBP1-59205) (0)

There are no reviews for Protocadherin-12 Antibody (NBP1-59205). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protocadherin-12 Antibody (NBP1-59205) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protocadherin-12 Products

Related Products by Gene

Bioinformatics Tool for Protocadherin-12 Antibody (NBP1-59205)

Discover related pathways, diseases and genes to Protocadherin-12 Antibody (NBP1-59205). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protocadherin-12 Antibody (NBP1-59205)

Discover more about diseases related to Protocadherin-12 Antibody (NBP1-59205).
 

Pathways for Protocadherin-12 Antibody (NBP1-59205)

View related products by pathway.

PTMs for Protocadherin-12 Antibody (NBP1-59205)

Learn more about PTMs related to Protocadherin-12 Antibody (NBP1-59205).

Blogs on Protocadherin-12

There are no specific blogs for Protocadherin-12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protocadherin-12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDH12
Entrez
Uniprot