Protocadherin-12 Antibody


Western Blot: Protocadherin 12 Antibody [NBP1-59205] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Protocadherin-12 Antibody Summary

Synthetic peptides corresponding to PCDH12(protocadherin 12) The peptide sequence was selected from the middle region of PCDH12. Peptide sequence SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PCDH12 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Protocadherin-12 Antibody

  • PCDH12
  • protocadherin 12
  • Protocadherin12
  • Protocadherin-12
  • Vascular cadherin-2
  • vascular endothelial cadherin 2
  • Vascular endothelial cadherin-2
  • VECAD2
  • VE-cad-2
  • VE-cadherin 2
  • VE-cadherin-2
  • VE-cadherin-2protocadherin-12


PCDH12 belongs to the protocadherin protein family, a subfamily of the cadherin superfamily. It consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The function of this cellular adhesion protein is undetermined but mouse protocadherin 12 does not bind catenins and appears to have no affect on cell migration or growth.This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The encoded protein consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The gene localizes to the region on chromosome 5 where the protocadherin gene clusters reside. The exon organization of this transcript is similar to that of the gene cluster transcripts, notably the first large exon, but no significant sequence homology exists. The function of this cellular adhesion protein is undetermined but mouse protocadherin 12 does not bind catenins and appears to have no affect on cell migration or growth.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, ICC/IF, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, Flow, IHC, AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB

Publications for Protocadherin-12 Antibody (NBP1-59205) (0)

There are no publications for Protocadherin-12 Antibody (NBP1-59205).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protocadherin-12 Antibody (NBP1-59205) (0)

There are no reviews for Protocadherin-12 Antibody (NBP1-59205). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protocadherin-12 Antibody (NBP1-59205) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Protocadherin-12 Antibody Products

Related Products by Gene

Bioinformatics Tool for Protocadherin-12 Antibody (NBP1-59205)

Discover related pathways, diseases and genes to Protocadherin-12 Antibody (NBP1-59205). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protocadherin-12 Antibody (NBP1-59205)

Discover more about diseases related to Protocadherin-12 Antibody (NBP1-59205).

Pathways for Protocadherin-12 Antibody (NBP1-59205)

View related products by pathway.

PTMs for Protocadherin-12 Antibody (NBP1-59205)

Learn more about PTMs related to Protocadherin-12 Antibody (NBP1-59205).

Blogs on Protocadherin-12

There are no specific blogs for Protocadherin-12, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Protocadherin-12 Antibody and receive a gift card or discount.


Gene Symbol PCDH12

Customers Who Bought This Also Bought