Protocadherin-1 Antibody - BSA Free

Western Blot: Protocadherin-1 Antibody [NBP1-59209] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Immunocytochemistry/Immunofluorescence: Protocadherin-1 Antibody [NBP1-59209] - Bronchial epithelial cell line (16HBE).

Western Blot: Protocadherin-1 Antibody [NBP1-59209] - N-terminal region validated by WB using bronchial epithelial cell line (16HBE).

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Protocadherin-1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PCDH1(protocadherin 1) The peptide sequence was selected from the N terminal of PCDH1. Peptide sequence LLPSMLLALLLLLAPSPGHATRVVYKVPEEQPPNTLIGSLAADYGFPDVG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCDH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Protocadherin-1 Antibody - BSA Free

• cadherin-like 1
• Cadherin-like protein 1
• FLJ53887
• MGC45991
• PC42
• PC42PCDH42
• PCDH1
• PCDH42
• protocadherin 1 (cadherin-like 1)
• protocadherin 1
• protocadherin 42
• Protocadherin1
• Protocadherin-1
• protocadherin-42

Background

PCDH1 belongs to the protocadherin subfamily within the cadherin superfamily. It is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity.This gene belongs to the protocadherin subfamily within the cadherin superfamily. The encoded protein is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity. Alternative splicing occurs in this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PCDH1
• Uniprot:
  • Q08174()