Protocadherin-1 Antibody


Western Blot: Protocadherin-1 Antibody [NBP1-59209] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.
Immunocytochemistry/ Immunofluorescence: Protocadherin-1 Antibody [NBP1-59209] - Bronchial epithelial cell line (16HBE).
Western Blot: Protocadherin-1 Antibody [NBP1-59209] - N-terminal region validated by WB using bronchial epithelial cell line (16HBE).

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF

Order Details

Protocadherin-1 Antibody Summary

Synthetic peptides corresponding to PCDH1(protocadherin 1) The peptide sequence was selected from the N terminal of PCDH1. Peptide sequence LLPSMLLALLLLLAPSPGHATRVVYKVPEEQPPNTLIGSLAADYGFPDVG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
Application Notes
This is a rabbit polyclonal antibody against PCDH1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Protocadherin-1 Antibody

  • cadherin-like 1
  • Cadherin-like protein 1
  • FLJ53887
  • MGC45991
  • PC42
  • PC42PCDH42
  • PCDH1
  • PCDH42
  • protocadherin 1 (cadherin-like 1)
  • protocadherin 1
  • protocadherin 42
  • Protocadherin1
  • Protocadherin-1
  • protocadherin-42


PCDH1 belongs to the protocadherin subfamily within the cadherin superfamily. It is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity.This gene belongs to the protocadherin subfamily within the cadherin superfamily. The encoded protein is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity. Alternative splicing occurs in this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, IF
Species: Hu
Applications: WB, ICC
Species: Hu
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, ELISA, IP
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Ma
Applications: WB
Species: Hu
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for Protocadherin-1 Antibody (NBP1-59209) (0)

There are no publications for Protocadherin-1 Antibody (NBP1-59209).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protocadherin-1 Antibody (NBP1-59209) (0)

There are no reviews for Protocadherin-1 Antibody (NBP1-59209). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Protocadherin-1 Antibody (NBP1-59209) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Protocadherin-1 Products

Bioinformatics Tool for Protocadherin-1 Antibody (NBP1-59209)

Discover related pathways, diseases and genes to Protocadherin-1 Antibody (NBP1-59209). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protocadherin-1 Antibody (NBP1-59209)

Discover more about diseases related to Protocadherin-1 Antibody (NBP1-59209).

Pathways for Protocadherin-1 Antibody (NBP1-59209)

View related products by pathway.

PTMs for Protocadherin-1 Antibody (NBP1-59209)

Learn more about PTMs related to Protocadherin-1 Antibody (NBP1-59209).

Blogs on Protocadherin-1

There are no specific blogs for Protocadherin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Protocadherin-1 Antibody and receive a gift card or discount.


Gene Symbol PCDH1