Recombinant Human Prostaglandin I2 Synthase Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Prostaglandin I2 Synthase Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 391-500 of Human PTGIS partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PQRDPEIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRSYAVNSIKQFVFLVLVHLDLELINADVEIPEFDLSRYGFGLMQPEHDVPVRYRIRP

Protein/Peptide Type
Partial Recombinant Protein
Gene
PTGIS

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Prostaglandin I2 Synthase Protein

  • CYP8
  • CYP8A1
  • CYP8A1PTGI
  • CYP8prostacyclin synthase
  • EC 5.3.99.4
  • MGC126858
  • MGC126860
  • PGIS
  • PGIScytochrome P450, family 8, subfamily A, polypeptide 1
  • Prostacyclin Synthase
  • prostaglandin I2 (prostacyclin) synthase
  • Prostaglandin I2 synthase
  • PTGI
  • PTGIS

Background

PTGIS - prostaglandin I2 (prostacyclin) synthase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF2667
Species: Hu
Applications: WB, IHC
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87852
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01) (0)

There are no publications for Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01) (0)

There are no reviews for Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Prostaglandin I2 Synthase Products

Bioinformatics Tool for Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01)

Discover related pathways, diseases and genes to Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01)

Discover more about diseases related to Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01).
 

Pathways for Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01)

View related products by pathway.

PTMs for Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01)

Learn more about PTMs related to Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01).

Blogs on Prostaglandin I2 Synthase

There are no specific blogs for Prostaglandin I2 Synthase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

COX-2 Antibody
NB100-689
eNOS Antibody
NB300-500

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Prostaglandin I2 Synthase Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PTGIS
Entrez