Recombinant Human Prostaglandin I2 Synthase Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Prostaglandin I2 Synthase Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 391-500 of Human Prostaglandin I2 Synthase

Source: Wheat Germ

Amino Acid Sequence: PQRDPEIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRSYAVNSIKQFVFLVLVHLDLELINADVEIPEFDLSRYGFGLMQPEHDVPVRYRIRP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PTGIS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Prostaglandin I2 Synthase Protein

  • CYP8
  • CYP8A1
  • CYP8A1PTGI
  • CYP8prostacyclin synthase
  • EC 5.3.99.4
  • MGC126858
  • MGC126860
  • PGIS
  • PGIScytochrome P450, family 8, subfamily A, polypeptide 1
  • Prostacyclin Synthase
  • prostaglandin I2 (prostacyclin) synthase
  • Prostaglandin I2 synthase
  • PTGI
  • PTGIS

Background

PTGIS - prostaglandin I2 (prostacyclin) synthase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-65875
Species: Hu
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87852
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01) (0)

There are no publications for Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01) (0)

There are no reviews for Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Prostaglandin I2 Synthase Products

Bioinformatics Tool for Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01)

Discover related pathways, diseases and genes to Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01)

Discover more about diseases related to Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01).
 

Pathways for Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01)

View related products by pathway.

PTMs for Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01)

Learn more about PTMs related to Prostaglandin I2 Synthase Partial Recombinant Protein (H00005740-Q01).

Blogs on Prostaglandin I2 Synthase

There are no specific blogs for Prostaglandin I2 Synthase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

COX-2 Antibody
NB100-689
eNOS Antibody
NB300-500

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Prostaglandin I2 Synthase Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PTGIS
Entrez