Recombinant Human PRMT5 Protein

Images

 
Recombinant Human PRMT5 Protein [H00010419-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PRMT5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-637 of Human SKB1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PRMT5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
95.81 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00010419-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PRMT5 Protein

  • EC 2.1.1.-
  • EC 2.1.1.125
  • Histone-arginine N-methyltransferase PRMT5
  • HMT1 hnRNP methyltransferase-like 5,72 kDa ICln-binding protein
  • HRMT1L5
  • IBP72
  • Jak-binding protein 1
  • JBP1
  • protein arginine methyltransferase 5
  • protein arginine N-methyltransferase 5
  • Shk1 kinase-binding protein 1 homolog
  • skb1 (S. pombe) homolog
  • SKB1 homolog (S. pombe)
  • SKB1
  • SKB1HsSKB1 homolog

Background

SKB1( AAH25979, 1 a.a. - 638 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-82778
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67074
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NLS3775
Species: Hu, Mk
Applications: ICC/IF, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-342
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
H00008294-P01
Species: Hu
H00008363-P01
Species: Hu
H00008362-P01
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP2-59451
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PRMT5 Recombinant Protein (H00010419-P01)(1)

Reviews for PRMT5 Recombinant Protein (H00010419-P01) (0)

There are no reviews for PRMT5 Recombinant Protein (H00010419-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRMT5 Recombinant Protein (H00010419-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRMT5 Products

Bioinformatics Tool for PRMT5 Recombinant Protein (H00010419-P01)

Discover related pathways, diseases and genes to PRMT5 Recombinant Protein (H00010419-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRMT5 Recombinant Protein (H00010419-P01)

Discover more about diseases related to PRMT5 Recombinant Protein (H00010419-P01).
 

Pathways for PRMT5 Recombinant Protein (H00010419-P01)

View related products by pathway.

PTMs for PRMT5 Recombinant Protein (H00010419-P01)

Learn more about PTMs related to PRMT5 Recombinant Protein (H00010419-P01).
 

Research Areas for PRMT5 Recombinant Protein (H00010419-P01)

Find related products by research area.

Blogs on PRMT5

There are no specific blogs for PRMT5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PRMT5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRMT5