PRKD3/nPKC nu Antibody (4G7)

Images

 
ELISA: PRKD3/nPKC nu Antibody (4G7) [H00023683-M01] - Detection limit for recombinant GST tagged PRKD3 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4G7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PRKD3/nPKC nu Antibody (4G7) Summary

Immunogen
Partial recombinant protein with GST tag, between amino acids 1-100 [NCBI#AAH30706].MSANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTVSFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPEC
Localization
Cytoplasm, nucleus.
Specificity
PRKD3 (4G7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRKD3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
This antibody is reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publications using H00023683-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PRKD3/nPKC nu Antibody (4G7)

  • EC 2.7.11
  • EC 2.7.11.13
  • EPK2
  • EPK2PKD3
  • nPKC nu
  • nPKC-nu
  • PKC nu
  • PKC-NU
  • PRKCN
  • PRKCNnPKC-NU
  • PRKD3
  • Protein kinase C nu type
  • protein kinase C, nu
  • protein kinase D3
  • Protein kinase EPK2
  • protein-serine/threonine kinase
  • serine/threonine-protein kinase D3

Background

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role. The protein encoded by this gene is one of the PKC family members. This kinase can be activated rapidly by the agonists of G protein-coupled receptors. It resides in both cytoplasm and nucleus, and its nuclear accumulation is found to be dramatically enhanced in response to its activation. This kinase can also be activated after B-cell antigen receptor (BCR) engagement, which requires intact phopholipase C gamma and the involvement of other PKC family members.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02984
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6270
Species: Hu
Applications: ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PRKD3/nPKC nu Antibody (H00023683-M01)(2)

Reviews for PRKD3/nPKC nu Antibody (H00023683-M01) (0)

There are no reviews for PRKD3/nPKC nu Antibody (H00023683-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRKD3/nPKC nu Antibody (H00023683-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRKD3/nPKC nu Products

Bioinformatics Tool for PRKD3/nPKC nu Antibody (H00023683-M01)

Discover related pathways, diseases and genes to PRKD3/nPKC nu Antibody (H00023683-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRKD3/nPKC nu Antibody (H00023683-M01)

Discover more about diseases related to PRKD3/nPKC nu Antibody (H00023683-M01).
 

Pathways for PRKD3/nPKC nu Antibody (H00023683-M01)

View related products by pathway.

Research Areas for PRKD3/nPKC nu Antibody (H00023683-M01)

Find related products by research area.

Blogs on PRKD3/nPKC nu

There are no specific blogs for PRKD3/nPKC nu, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRKD3/nPKC nu Antibody (4G7) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKD3
Entrez
OMIM
Uniprot