PPP3R2 Antibody

Images

 
Western Blot: PPP3R2 Antibody [H00005535-B01P] - Analysis of PPP3R2 expression in transfected 293T cell line by PPP3R2 polyclonal antibody. Lane 1: PPP3R2 transfected lysate(19.03 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PPP3R2 Antibody Summary

Immunogen
PPP3R2 (NP_671709.1, 1 a.a. - 173 a.a.) full-length human protein. MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PPP3R2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPP3R2 Antibody

  • calcineurin B, type II (19kDa)
  • Calcineurin BII
  • Calcineurin B-like protein
  • calcineurin subunit B type 2
  • CBLP
  • CNBII
  • PPP3RL
  • Protein phosphatase 2B regulatory subunit 2
  • protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), beta isoform(calcineurin B, type II)
  • protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, beta isoform(calcineurin B, type II)
  • protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform
  • Protein phosphatase 3 regulatory subunit B beta isoform
  • protein phosphatase 3, regulatory subunit B, beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-78063
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF1348
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56695
Species: Hu
Applications: WB
AF6260
Species: Hu
Applications: WB
NBP2-13426
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30656
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-33041
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86656
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32567
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46538
Species: Hu
Applications: WB, IHC
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
AF2200
Species: Hu
Applications: WB, IP
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
H00005535-B01P
Species: Hu
Applications: WB

Publications for PPP3R2 Antibody (H00005535-B01P) (0)

There are no publications for PPP3R2 Antibody (H00005535-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP3R2 Antibody (H00005535-B01P) (0)

There are no reviews for PPP3R2 Antibody (H00005535-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP3R2 Antibody (H00005535-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP3R2 Products

Bioinformatics Tool for PPP3R2 Antibody (H00005535-B01P)

Discover related pathways, diseases and genes to PPP3R2 Antibody (H00005535-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP3R2 Antibody (H00005535-B01P)

Discover more about diseases related to PPP3R2 Antibody (H00005535-B01P).
 

Pathways for PPP3R2 Antibody (H00005535-B01P)

View related products by pathway.

PTMs for PPP3R2 Antibody (H00005535-B01P)

Learn more about PTMs related to PPP3R2 Antibody (H00005535-B01P).
 

Research Areas for PPP3R2 Antibody (H00005535-B01P)

Find related products by research area.

Blogs on PPP3R2

There are no specific blogs for PPP3R2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP3R2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP3R2
Uniprot