PPP3R2 Antibody - Azide and BSA Free Summary
| Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen |
PPP3R2 (NP_671709.1, 1 a.a. - 173 a.a.) full-length human protein. MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
PPP3R2 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
It has been used for WB and Functional. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for PPP3R2 Antibody - Azide and BSA Free
Background
PPP3R2 also known as Calcineurin subunit B type 2, is a 170 amino acid protein that is 20 kDa, is testis-specific, is a regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase, and confers calcium sensitivity. This protein is being studied for its involvement in amyotrophic lateral sclerosis (als), amyotrophic lateral sclerosis, lateral sclerosis, tuberculosis, malaria, and neuronitis. PPP3R2 protein is involved is several pathways including MAPK signaling pathway, Alzheimer's Disease, Energy Metabolism, Calcium signaling pathway, Oocyte meiosis, Apoptosis, Wnt signaling pathway, Tacrolimus/Cyclosporine Pathway, Pharmacodynamics, 14-3-3 Induced Apoptosis, Intracellular Calcium Signaling, PI3K Signaling in B-Lymphocyte, IL-2 Pathway, and ITK and TCR Signaling Pathway where it interacts with TBC1D10C, PLCG1, PLCG2, ANAPC1, ANAPC10, and approx. 30 other proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IP, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Publications for PPP3R2 Antibody (H00005535-B01P) (0)
There are no publications for PPP3R2 Antibody (H00005535-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PPP3R2 Antibody (H00005535-B01P) (0)
There are no reviews for PPP3R2 Antibody (H00005535-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PPP3R2 Antibody (H00005535-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PPP3R2 Products
Research Areas for PPP3R2 Antibody (H00005535-B01P)
Find related products by research area.
|
Blogs on PPP3R2