PPP2R5D Recombinant Protein Antigen

Images

 
There are currently no images for PPP2R5D Protein (NBP1-88960PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PPP2R5D Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP2R5D.

Source: E. coli

Amino Acid Sequence: PKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPSNSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPAL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPP2R5D
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88960.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PPP2R5D Recombinant Protein Antigen

  • MGC2134
  • MGC8949
  • PP2A B subunit isoform B56-delta
  • PP2A B subunit isoform B'-delta
  • PP2A B subunit isoform PR61-delta
  • PP2A B subunit isoform R5-delta
  • PP2A, B subunit, B' delta isoform
  • PP2A, B subunit, B56 delta isoform
  • PP2A, B subunit, PR61 delta isoform
  • PP2A, B subunit, R5 delta isoform
  • protein phosphatase 2, regulatory subunit B', delta
  • regulatory subunit B (B56), delta isoform
  • regulatory subunit B', delta isoform
  • Serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, deltaisoform
  • serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform

Background

PP2A is a major serine/threonine phosphatase that is implicated in the negative control of cell cycle progression. It is a trimeric holoenzyme that is comprised of a catalytic, structural, and regulatory subunit. PPP2R5D is a regulatory subunit of PP2A. The regulatory subunits of PP2A are grouped into 3 families: B/PR55, B'/PR61, and B''/PR72. PPP2R5D encodes the delta isoform of the B' subunit, B56. PPP2R5D may function to localize PP2A to the nucleus. Alternate designations for PPP2R5D include serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform, PP2A B subunit B' delta isoform, PP2A B subunit B56 delta isoform, PP2A B subunit PR61 delta isoform, PP2A B subunit R5 delta isoform, B56D, MGC2134, and MGC8949.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87232
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF3088
Species: Mu
Applications: WB
NBP3-46376
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP2-37602
Species: Hu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-33402
Species: Hu
Applications: ICC/IF, WB
NBP1-91952
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-45224
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-47470
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
DVC00
Species: Hu
Applications: ELISA
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF4429
Species: Mu
Applications: IHC, WB
AF6526
Species: Hu
Applications: WB
NBP2-22523
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88960PEP
Species: Hu
Applications: AC

Publications for PPP2R5D Protein (NBP1-88960PEP) (0)

There are no publications for PPP2R5D Protein (NBP1-88960PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2R5D Protein (NBP1-88960PEP) (0)

There are no reviews for PPP2R5D Protein (NBP1-88960PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PPP2R5D Protein (NBP1-88960PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPP2R5D Products

Research Areas for PPP2R5D Protein (NBP1-88960PEP)

Find related products by research area.

Blogs on PPP2R5D

There are no specific blogs for PPP2R5D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PPP2R5D Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R5D