PPP2R3A Recombinant Protein Antigen

Images

 
There are currently no images for PPP2R3A Recombinant Protein Antigen (NBP2-55833PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PPP2R3A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP2R3A.

Source: E. coli

Amino Acid Sequence: FSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCSEDLKKCTDIIKQCIKKKSGSSISEGSGNDTISSSETVYMNVMTRLA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPP2R3A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55833.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PPP2R3A Recombinant Protein Antigen

  • PP2A subunit B isoform R3 isoform
  • PP2A subunit B isoforms B72/B130
  • PP2A subunit B isoforms B'-PR72/PR130
  • protein phosphatase 2 (formerly 2A), regulatory subunit B' (PR 72), alphaisoform and (PR 130), beta isoform
  • protein phosphatase 2 (formerly 2A), regulatory subunit B', alpha
  • protein phosphatase 2, regulatory subunit B', alpha
  • serine/threonine-protein phosphatase 2A regulatory subunit B' subunit alpha
  • subunit B, R3 isoform

Background

PPP2R3A is a gene that codes for a protein with three isoforms, with lengths of 1150, 529, and 414 amino acids and weights of approximately 130, 61, and 48 kDa respectively. PPP2R3A is thought to modulate substrate selectivity and catalytic activity, as well as facilitate in the localization of catalytic enzymes. Current studies are being done on diseases and disorders related to this gene including retinoblastoma, ataxia, immunodeficiency, malaria, neuronitis, and breast cancer. PPP2R3A has also been shown to have interactions with ATXN7L2, PPP2CA, PPP5C, CDC6, and PPP2R1A in pathways such as the signal transduction PKA signaling, CDK5, mTOR, cell cycle regulation, Wnt signaling, glycogen metabolism, and IL-6 signaling pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87232
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00028227-M08
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
NBP2-33735
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB4230
Species: Mu, Rt
Applications: IHC, WB
NBP2-93798
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-87251
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP2-37602
Species: Hu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP2-37592
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-33479
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-55833PEP
Species: Hu
Applications: AC

Publications for PPP2R3A Recombinant Protein Antigen (NBP2-55833PEP) (0)

There are no publications for PPP2R3A Recombinant Protein Antigen (NBP2-55833PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2R3A Recombinant Protein Antigen (NBP2-55833PEP) (0)

There are no reviews for PPP2R3A Recombinant Protein Antigen (NBP2-55833PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PPP2R3A Recombinant Protein Antigen (NBP2-55833PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPP2R3A Products

Blogs on PPP2R3A

There are no specific blogs for PPP2R3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PPP2R3A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R3A