PPP1R14B Antibody (4G2) - Azide and BSA Free

Western Blot: PPP1R14B Antibody (4G2) [H00026472-M07] - Analysis of PPP1R14B expression in transfected 293T cell line by PPP1R14B monoclonal antibody (M07), clone 4G2. Lane 1: PPP1R14B transfected lysate (Predicted MW: 16.17 KDa). Lane 2: Non-transfected lysate.

Sandwich ELISA: PPP1R14B Antibody (4G2) [H00026472-M07] - Detection limit for recombinant GST tagged PPP1R14B is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4G2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PPP1R14B Antibody (4G2) - Azide and BSA Free Summary

• Immunogen: PPP1R14B (NP_619634.1, 64 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQ
• Specificity: This product is specific for Human PPP1R14B monoclonal antibody (M07), clone 4G2 [Gene ID: 26472].
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PPP1R14B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Mouse monoclonal antibody raised against a partial recombinant PPP1R14B.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPP1R14B Antibody (4G2) - Azide and BSA Free

• PHI-1
• PLCB3Nphospholipase C beta-3 neighboring gene protein
• PNGPhospholipase C-beta-3 neighbouring gene protein
• protein phosphatase 1 regulatory subunit 14B
• protein phosphatase 1, regulatory (inhibitor) subunit 14B
• SOM172

Background

Inhibitor of PPP1CA. Has over 50-fold higher inhibitory activity when phosphorylated

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP1R14B
• Uniprot:
  • NP_619634.1(Human)