New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

PPP1R11 Antibody


Western Blot: PPP1R11 Antibody [NBP1-70681] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PPP1R11 Antibody Summary

Synthetic peptides corresponding to PPP1R11(protein phosphatase 1, regulatory (inhibitor) subunit 11) The peptide sequence was selected from the N terminal of PPP1R11. Peptide sequence MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDN. The peptide sequence for this immunogen was taken from within the described region.
This product is specific to Subunit or Isoform: 11.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PPP1R11 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PPP1R11 Antibody

  • HCG V
  • HCG-V
  • inhibitor-3
  • IPP3
  • protein phosphatase 1 regulatory subunit 11
  • protein phosphatase 1, regulatory (inhibitor) subunit 11
  • TCTE5
  • TCTEX5


This gene encodes a specific inhibitor of protein phosphatase-1 (PP1) with a differential sensitivity toward the metal-independent and metal-dependent forms of PP1. The gene is located within the major histocompatibility complex class I region on chromoso


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC/IF, WB
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, KO, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
Species: Hu
Applications: WB

Publications for PPP1R11 Antibody (NBP1-70681) (0)

There are no publications for PPP1R11 Antibody (NBP1-70681).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP1R11 Antibody (NBP1-70681) (0)

There are no reviews for PPP1R11 Antibody (NBP1-70681). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP1R11 Antibody (NBP1-70681) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PPP1R11 Products

Bioinformatics Tool for PPP1R11 Antibody (NBP1-70681)

Discover related pathways, diseases and genes to PPP1R11 Antibody (NBP1-70681). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP1R11 Antibody (NBP1-70681)

Discover more about diseases related to PPP1R11 Antibody (NBP1-70681).

Pathways for PPP1R11 Antibody (NBP1-70681)

View related products by pathway.

PTMs for PPP1R11 Antibody (NBP1-70681)

Learn more about PTMs related to PPP1R11 Antibody (NBP1-70681).

Blogs on PPP1R11

There are no specific blogs for PPP1R11, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PPP1R11 Antibody and receive a gift card or discount.


Gene Symbol PPP1R11