Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.
![Western Blot: PPP1R11 Antibody [NBP1-70681] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.](http://images.novusbio.com/fullsize2/PPP1R11-Antibody-Western-Blot-NBP1-70681-img0003.jpg "Western Blot: PPP1R11 Antibody [NBP1-70681] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptides corresponding to PPP1R11(protein phosphatase 1, regulatory (inhibitor) subunit 11) The peptide sequence was selected from the N terminal of PPP1R11.
Peptide sequence MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDN. The peptide sequence for this immunogen was taken from within the described region. |
| Specificity | This product is specific to Subunit or Isoform: 11. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PPP1R11 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This is a rabbit polyclonal antibody against PPP1R11 and was validated on Western blot. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry/Immunofluorescence: HSP60 Antibody [NBP1-77397] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with HSP60 Antibody (NBP1-77397) at 1 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.](http://images.novusbio.com/images2/HSP60-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-77397-img0015.jpg)
![Immunocytochemistry/Immunofluorescence: HSP60 Antibody [NBP1-77397] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with HSP60 Antibody conjugated to Alexa Fluor 488 (NBP1-77397AF488) at 5 ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.](http://images.novusbio.com/images2/HSP60-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-77397-img0016.jpg)
![Immunocytochemistry/Immunofluorescence: HSP60 Antibody - BSA Free [NBP1-77397] - Mouse MS1 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with HSP60 Antibody (NBP1-77397) at 2ug/ml overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.](http://images.novusbio.com/images2/HSP60-Antibody---BSA-Free-Immunocytochemistry-Immunofluorescence-NBP1-77397-img0017.jpg)
![Immunocytochemistry/Immunofluorescence: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.](http://images.novusbio.com/images2/Inorganic-Pyrophosphatase-PPA1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31348-img0008.jpg)
![Immunohistochemistry-Paraffin: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Paraffin-embedded OVCAR3 xenograft, using antibody at 1:500 dilution.](http://images.novusbio.com/images2/Inorganic-Pyrophosphatase-PPA1-Antibody-Immunohistochemistry-Paraffin-NBP1-31348-img0009.jpg)
![Western Blot: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Sample (30 ug of whole cell lysate) A: H1299 B: Hela C: Hep G2 D: Molt-4 12% SDS PAGE; antibody diluted at 1:10000.](http://images.novusbio.com/images2/Inorganic-Pyrophosphatase-PPA1-Antibody-Western-Blot-NBP1-31348-img0010.jpg)
![Immunohistochemistry: TCP10 Antibody (2C2) [NBP2-46090] - Analysis of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)](http://images.novusbio.com/images2/TCP10-Antibody-(2C2)-Immunohistochemistry-NBP2-46090-img0001.jpg)
![Immunohistochemistry: TCP10 Antibody (2C2) [NBP2-46090] - Analysis of Human Kidney tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)](http://images.novusbio.com/images2/TCP10-Antibody-(2C2)-Immunohistochemistry-NBP2-46090-img0002.jpg)
![Immunohistochemistry: TCP10 Antibody (2C2) [NBP2-46090] - Analysis of Human Ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)](http://images.novusbio.com/images2/TCP10-Antibody-(2C2)-Immunohistochemistry-NBP2-46090-img0003.jpg)
![Western Blot: TCTE3 Antibody [NBP2-81956] - Analysis of TCTE3 in EL4 cell lysate with TCTE3 antibody at 1 ug/ml in the (A) absence and (B) presence of blocking peptide.](http://images.novusbio.com/images2/TCTE3-Antibody-Western-Blot-NBP2-81956-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: TCTE3 Antibody [NBP2-81956] - Analysis of TCTE3 in human testis tissue with TCTE3 antibody at 20 ug/ml.](http://images.novusbio.com/images2/TCTE3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-81956-img0002.jpg)
![Western Blot: DYNLT1 Antibody [NBP2-58497] - Analysis in human cell line RT-4 and human cell line U-251 MG.](http://images.novusbio.com/images2/DYNLT1-Antibody-Western-Blot-NBP2-58497-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: DYNLT1 Antibody [NBP2-58497] - Staining of human cell line U-251 MG shows localization to nucleoplasm.](http://images.novusbio.com/images2/DYNLT1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58497-img0001.jpg)
![Western Blot: PPP1R7 Antibody (4F9) [NBP1-47924] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PPP1R7 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PPP1R7.](http://images.novusbio.com/images/PPP1R7-Antibody-(4F9)-Western-Blot-NBP1-47924-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: PPP1R7 Antibody (4F9) [NBP1-47924] - Immunofluorescent staining of HT29 cells using anti-PPP1R7 mouse monoclonal antibody.](http://images.novusbio.com/images/PPP1R7-Antibody-(4F9)-Immunocytochemistry-Immunofluorescence-NBP1-47924-img0002.jpg)
![Immunohistochemistry-Paraffin: PPP1R7 Antibody (4F9) [NBP1-47924] - Staining of paraffin-embedded Adenocarcinoma of Human colon tissue using anti-PPP1R7 mouse monoclonal antibody.](http://images.novusbio.com/images/PPP1R7-Antibody-(4F9)-Immunohistochemistry-Paraffin-NBP1-47924-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: MTG1 Antibody [NBP2-98486] - Immunofluorescence staining of MTG1 in U2OS cells. Cells were fixed with 4% PFA, permeabilzed with 0.1% Triton X-100 in PBS, blocked with 10% serum, and incubated with rabbit anti-Human MTG1 polyclonal antibody (dilution ratio 1:100) at 4C overnight. Then cells were stained with the Alexa Fluor(R)488-conjugated Goat Anti-rabbit IgG secondary antibody (green) and counterstained with DAPI (blue).Positive staining was localized to Cytoplasm.](http://images.novusbio.com/images2/MTG1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-98486-img0001.jpg)
![Immunohistochemistry-Paraffin: MTG1 Antibody [NBP2-98486] - Immunochemical staining of human MTG1 in human kidney with rabbit polyclonal antibody at 1:100 dilution, formalin-fixed paraffin embedded sections.](http://images.novusbio.com/images2/MTG1-Antibody-Immunohistochemistry-Paraffin-NBP2-98486-img0003.jpg)
![Western Blot: MTG1 Antibody [NBP2-98486] - Anti-MTG1 rabbit polyclonal antibody at 1:500 dilution. Lane A: Jurkat Whole Cell Lysate Lane B: U-251 MG Whole Cell Lysate Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 37 kDa. Observed band size: 33 kDa.](http://images.novusbio.com/images2/MTG1-Antibody-Western-Blot-NBP2-98486-img0004.jpg)
![Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Analysis using the PE/Cy5 conjugate of NB100-64775. Staining of normal human peripheral blood cells with Mouse IgG2a K Isotype Control PE-Cy5 (NBP1-43073) (blue histogram) or Anti-Human HLA-ABC PE-Cy5 (purple histogram). Cells in the lymphocyte gate were](http://images.novusbio.com/images2/HLA-ABC-Antibody-(W6-32)-Flow-Cytometry-NB100-64775-img0014.jpg)
![Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Analysis using the FITC conjugate of NB100-64775. Staining of normal human peripheral blood cells with Mouse IgG2a K Isotype Control FITC (NBP1-43955) (blue histogram) or Anti-Human HLA-ABC FITC (purple histogram). Cells in the lymphocyte gate were used f](http://images.novusbio.com/images2/HLA-ABC-Antibody-(W6-32)-Flow-Cytometry-NB100-64775-img0013.jpg)
![Immunohistochemistry-Frozen: HLA ABC Antibody (W6/32) [NB100-64775] - Analysis of Mouse colon cancer tissue using HLA ABC antibody (W6/32). Primary antibody dilution was 1:100. Sample was incubated with secondary antibody in 1:300 dilution. Image from verified customer review.](http://images.novusbio.com/images2/HLA-ABC-Antibody-(W6-32)-Immunohistochemistry-Frozen-NB100-64775-img0015.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for PPP1R11 Antibody (NBP1-70681)Discover more about diseases related to PPP1R11 Antibody (NBP1-70681).
| Pathways for PPP1R11 Antibody (NBP1-70681)View related products by pathway.
|
PTMs for PPP1R11 Antibody (NBP1-70681)Learn more about PTMs related to PPP1R11 Antibody (NBP1-70681).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PPP1R11 |
![Western Blot: TCP1 alpha Antibody [NB100-1400] - Staining of Human Ovary (A) lysate and HEK293 (B) cell lysate (35 ug protein in RIPA buffer). Antibody at 1 ug/mL. Detected by chemiluminescence.](http://images.novusbio.com/images2/TCP1-alpha-Antibody-Western-Blot-NB100-1400-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: TCP1 alpha Antibody [NB100-1400] - Analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml), showing cytoplasmic and nuclear staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml).](http://images.novusbio.com/images2/TCP1-alpha-Antibody-Immunocytochemistry-Immunofluorescence-NB100-1400-img0005.jpg)
![Flow Cytometry: TCP1 alpha Antibody [NB100-1400] - Analysis of paraformaldehyde fixed HeLa cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (1ug/ml). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.](http://images.novusbio.com/images2/TCP1-alpha-Antibody-Flow-Cytometry-NB100-1400-img0006.jpg)
![Western Blot: MARVELD2 Antibody [NB100-74633] - Detection of Human MARVELD2/Tricellulinon HeLa whole cell lysate using NB100-74633. MARVELD2/Tricellulin was also immunoprecipitated by rabbit anti-MARVELD2/Tricellulin antibody NB100-74632.](http://images.novusbio.com/images2/MARVELD2-Antibody-Western-Blot-NB100-74633-img0002.jpg)
![Western Blot: TCP11 Antibody [NBP1-57698] - Human Small Intestine, concentration 0.2-1 ug/ml.](http://images.novusbio.com/images2/TCP11-Antibody-Western-Blot-NBP1-57698-img0002.jpg)
![Immunohistochemistry-Paraffin: MSX2 Antibody [NBP1-85445] - Staining of human urinary bladder shows weak nuclear positivity in urothelial cells.](http://images.novusbio.com/images2/MSX2-Antibody-Immunohistochemistry-Paraffin-NBP1-85445-img0012.jpg)
![Immunohistochemistry-Paraffin: MSX2 Antibody [NBP1-85445] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/images2/MSX2-Antibody-Immunohistochemistry-Paraffin-NBP1-85445-img0013.jpg)
![Immunohistochemistry-Paraffin: MSX2 Antibody [NBP1-85445] - Staining of human liver shows low positivity in hepatocytes as expected.](http://images.novusbio.com/images2/MSX2-Antibody-Immunohistochemistry-Paraffin-NBP1-85445-img0014.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](http://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")