PPHLN1 Antibody (4B6) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: PPHLN1 Antibody (4B6) [H00051535-M01] - Analysis of monoclonal antibody to PPHLN1 on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: PPHLN1 Antibody (4B6) [H00051535-M01] - Detection limit for recombinant GST tagged PPHLN1 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 4B6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PPHLN1 Antibody (4B6) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PPHLN1 Antibody (4B6) - Azide and BSA Free (H00051535-M01) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PPHLN1 (NP_958846.1, 168 a.a. ~ 258 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KVLDKPSRLTEKELAEAASKWAAEKLEKSDESNLPEISEYEAGSTAPLFTDQPEEPESNTTHGIELFEDSQLTTRSKAIASKTKEIEQVRV
• Specificity: PPHLN1 - periphilin 1 (4B6)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PPHLN1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPHLN1 Antibody (4B6) - Azide and BSA Free

• Gastric cancer antigen Ga50
• HSPC232
• MGC48786
• periphilin 1
• periphilin-1

Background

The protein encoded by this gene is one of the several proteins that become sequentially incorporated into the cornified cell envelope during the terminal differentiation of keratinocyte at the outer layers of epidermis. This protein interacts with periplakin, which is known as a precursor of the cornified cell envelope. The cellular localization pattern and insolubility of this protein suggest that it may play a role in epithelial differentiation and contribute to epidermal integrity and barrier formation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPHLN1
• Entrez:
  • 51535(Human)
• Uniprot:
  • NP_958846(Human)