PPFIA4 Antibody (3B1)

Images

 
Sandwich ELISA: PPFIA4 Antibody (3B1) [H00008497-M10] - Detection limit for recombinant GST tagged PPFIA4 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3B1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PPFIA4 Antibody (3B1) Summary

Immunogen
PPFIA4 (NP_055868 604 a.a. - 699 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RQVMEREFNNLLALGTDRKLDDGDDKVFRRAPSWRKRFRPREHHGRGGMLSASAETLPAGFRVSTLGTLQPPPAPPKKIMPEAHSHYLYGHMLSAF
Specificity
PPFIA4 (3B1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PPFIA4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPFIA4 Antibody (3B1)

  • KIAA0897
  • liprin alpha4
  • Liprin-alpha4
  • liprin-alpha-4
  • Protein tyrosine phosphatase receptor type f polypeptide-interacting proteinalpha-4
  • protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interactingprotein (liprin), alpha 4
  • PTPRF-interacting protein alpha-4

Background

PPFIA4, or liprin-alpha-4, belongs to the liprin-alpha gene family. See liprin-alpha-1 (LIP1, or PPFIA1; MIM 611054) for background on liprins.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
21720002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00022999-R01
Species: Hu
NBP2-30453
Species: Hu
Applications: IHC, IHC-P
NBP2-42172
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, ICC
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00085329-T01
Species: Hu
MAB8508
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, CyTOF-ready, ICFlow
NBP1-80033
Species: Hu
Applications: WB
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-33037
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01819
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-43633
Species: Hu
Applications: WB, ICC/IF
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-58006
Species: Hu
Applications: WB, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-45825
Species: Hu
Applications: WB, IHC
H00008497-M10
Species: Hu
Applications: WB, ELISA

Publications for PPFIA4 Antibody (H00008497-M10) (0)

There are no publications for PPFIA4 Antibody (H00008497-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPFIA4 Antibody (H00008497-M10) (0)

There are no reviews for PPFIA4 Antibody (H00008497-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPFIA4 Antibody (H00008497-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PPFIA4 Antibody (H00008497-M10)

Discover related pathways, diseases and genes to PPFIA4 Antibody (H00008497-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for PPFIA4 Antibody (H00008497-M10)

View related products by pathway.

PTMs for PPFIA4 Antibody (H00008497-M10)

Learn more about PTMs related to PPFIA4 Antibody (H00008497-M10).
 

Research Areas for PPFIA4 Antibody (H00008497-M10)

Find related products by research area.

Blogs on PPFIA4

There are no specific blogs for PPFIA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPFIA4 Antibody (3B1) and receive a gift card or discount.

Bioinformatics

Gene Symbol PPFIA4
Entrez
OMIM
Uniprot